UCH-L5/UCH37 Antibody

Images

 
Western Blot: UCH-L5/UCH37 Antibody [NBP2-57955] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: UCH-L5/UCH37 Antibody [NBP2-57955] - Staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UCH-L5/UCH37 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDT
Specificity
Specificity of human UCH-L5/UCH37 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UCHL5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UCH-L5/UCH37 Recombinant Protein Antigen (NBP2-57955PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for UCH-L5/UCH37 Antibody

  • CGI-70
  • EC 3.4.19.12
  • INO80 complex subunit R
  • INO80R
  • ubiquitin carboxyl-terminal esterase L5
  • ubiquitin carboxyl-terminal hydrolase isozyme L5
  • ubiquitin carboxyl-terminal hydrolase L5
  • Ubiquitin C-terminal hydrolase UCH37
  • Ubiquitin thioesterase L5
  • UCH37
  • UCH37CGI-70
  • UCHL5
  • UCH-L5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30447
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-86037
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
H00009097-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-80956
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78758
Species: Hu
Applications: WB (-), IP
NBP1-80835
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90821
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-264
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-80961
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48321
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NB100-513
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P, Single Cell Western
NBP1-83254
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60521
Species: Hu
Applications: WB, Flow
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-57955
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for UCH-L5/UCH37 Antibody (NBP2-57955) (0)

There are no publications for UCH-L5/UCH37 Antibody (NBP2-57955).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UCH-L5/UCH37 Antibody (NBP2-57955) (0)

There are no reviews for UCH-L5/UCH37 Antibody (NBP2-57955). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UCH-L5/UCH37 Antibody (NBP2-57955) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for UCH-L5/UCH37 Antibody (NBP2-57955)

Discover related pathways, diseases and genes to UCH-L5/UCH37 Antibody (NBP2-57955). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UCH-L5/UCH37 Antibody (NBP2-57955)

Discover more about diseases related to UCH-L5/UCH37 Antibody (NBP2-57955).
 

Pathways for UCH-L5/UCH37 Antibody (NBP2-57955)

View related products by pathway.

PTMs for UCH-L5/UCH37 Antibody (NBP2-57955)

Learn more about PTMs related to UCH-L5/UCH37 Antibody (NBP2-57955).

Blogs on UCH-L5/UCH37

There are no specific blogs for UCH-L5/UCH37, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UCH-L5/UCH37 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UCHL5
Entrez