Recombinant Human UCH-L1/PGP9.5 Protein

Images

 
SDS-Page: PGP9.5 / UCHL-1 Partial Recombinant Protein [H00007345-Q02] - 12.5%, Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related UCH-L1/PGP9.5 Peptides and Proteins

Order Details


    • Catalog Number
      H00007345-Q02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human UCH-L1/PGP9.5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 101-190 of Human UCHL1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
UCHL1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UCH-L1/PGP9.5 Protein

  • EC 3.4.19.12
  • EC 6.-
  • Neuron cytoplasmic protein 9.5
  • PARK5
  • PGP 9.5
  • PGP9.5
  • PGP9.5Uch-L1
  • PGP95
  • ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
  • ubiquitin carboxyl-terminal hydrolase isozyme L1
  • ubiquitin C-terminal hydrolase
  • Ubiquitin thioesterase L1
  • UCHL1
  • UCH-L1

Background

UCHL1 - ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6008
Species: Hu, Mu, Rt
Applications: WB
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IP, In vitro
H00007345-Q02
Species: Hu
Applications: WB, ELISA, PA

Publications for UCH-L1/PGP9.5 Partial Recombinant Protein (H00007345-Q02) (0)

There are no publications for UCH-L1/PGP9.5 Partial Recombinant Protein (H00007345-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UCH-L1/PGP9.5 Partial Recombinant Protein (H00007345-Q02) (0)

There are no reviews for UCH-L1/PGP9.5 Partial Recombinant Protein (H00007345-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UCH-L1/PGP9.5 Partial Recombinant Protein (H00007345-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UCH-L1/PGP9.5 Products

Bioinformatics Tool for UCH-L1/PGP9.5 Partial Recombinant Protein (H00007345-Q02)

Discover related pathways, diseases and genes to UCH-L1/PGP9.5 Partial Recombinant Protein (H00007345-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UCH-L1/PGP9.5 Partial Recombinant Protein (H00007345-Q02)

Discover more about diseases related to UCH-L1/PGP9.5 Partial Recombinant Protein (H00007345-Q02).
 

Pathways for UCH-L1/PGP9.5 Partial Recombinant Protein (H00007345-Q02)

View related products by pathway.

PTMs for UCH-L1/PGP9.5 Partial Recombinant Protein (H00007345-Q02)

Learn more about PTMs related to UCH-L1/PGP9.5 Partial Recombinant Protein (H00007345-Q02).
 

Research Areas for UCH-L1/PGP9.5 Partial Recombinant Protein (H00007345-Q02)

Find related products by research area.

Blogs on UCH-L1/PGP9.5

There are no specific blogs for UCH-L1/PGP9.5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UCH-L1/PGP9.5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UCHL1
Entrez