UBL5 Antibody (2F7) - Azide and BSA Free

Western Blot: UBL5 Antibody (2F7) [H00059286-M01] - Detection against Immunogen (33.77 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 2F7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

UBL5 Antibody (2F7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse UBL5 Antibody (2F7) - Azide and BSA Free (H00059286-M01) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. Anti-UBL5 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: UBL5 (NP_077268, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
• Specificity: UBL5 - ubiquitin-like 5
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: UBL5
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UBL5 Antibody (2F7) - Azide and BSA Free

• FLJ46917
• HUB1
• MGC131795
• ubiquitin-like 5
• ubiquitin-like protein 5

Background

Ubiquitin-like proteins (UBLs) are thought to be reversible modulators of protein function rather than protein degraders like ubiquitin (MIM 191339).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for UBL5 Antibody (H00059286-M01)(1)

Publication using H00059286-M01

• Surnamesveda G, Surnamecastoralova G, Surnamelipov G et al. Human UBL5 protein interacts with coilin and meets the Cajal bodies. Biochem Biophys Res Commun 2013-05-30 [PMID: 23726919] (Human)

Bioinformatics

• Gene Symbol: UBL5
• Entrez:
  • 59286(Human)
• OMIM:
  • 606849(Human)
• Uniprot:
  • NP_077268(Human)