Reactivity | HuSpecies Glossary |
Applications | WB, IHC |
Clone | 83406 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Biotin |
Immunogen | Human Ubiquitin+1 synthetic peptide SSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQ LEDGRTLSDYNIQKESTLHLVLRLRGYADLREDPDRQDHHPGSGAQ |
Specificity | Detects human Ubiquitin/Ubiquitin+1 in Western blots.. |
Isotype | IgG2b |
Clonality | Monoclonal |
Host | Mouse |
Gene | UBB |
Purity | Protein A or G purified from hybridoma culture supernatant |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | Optimal dilution of this antibody should be experimentally determined. |
Storage | Store at 4C in the dark. |
Buffer | PBS |
Preservative | 0.05% Sodium Azide |
Purity | Protein A or G purified from hybridoma culture supernatant |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | UBB |