UBE4B Antibody - BSA Free

Western Blot: UBE4B Antibody [NBP3-35766] - Western blot analysis of various lysates using UBE4B Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UBE4B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UBE4B Antibody - BSA Free (NBP3-35766) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 130-250 of human UBE4B (NP_006039.2).
  
  Sequence:
  EVDENDRREKRSLSDKEPSSGPEVSEEQALQLVCKIFRVSWKDRDRDVIFLSSLSAQFKQNPKEVFSDFKDLIGQILMEVLMMSTQTRDENPFASLTATSQPIAAAARSPDRNLLLNTGSN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBE4B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 146 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for UBE4B Antibody - BSA Free

• E4
• homologous to yeast UFD2
• Homozygously deleted in neuroblastoma 1
• homozygously deleted in neuroblastoma-1
• KIAA0684HDNB1
• UBE4B
• ubiquitin conjugation factor E4 B
• Ubiquitin fusion degradation protein 2
• ubiquitination factor E4B (homologous to yeast UFD2)
• ubiquitination factor E4B (UFD2 homolog, yeast)
• ubiquitin-fusion degradation protein 2
• UBOX3
• UFD2
• UFD2a
• UFD2UFD2A

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. This gene is also the strongest candidate in the neuroblastoma tumor suppressor genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBE4B