UBE3C Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: UBE3C Antibody [NBP2-94023] - Analysis of U2OS cells using UBE3C . Blue: DAPI for nuclear staining.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UBE3C Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UBE3C Antibody - BSA Free (NBP2-94023) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 970-1083 of human UBE3C (NP_055486.2). PISLEDLKSFTNYSGGYSADHPVIKVFWRVVEGFTDEEKRKLLKFVTSCSRPPLLGFKELYPAFCIHNGGSDLERLPTASTCMNLLKLPEFYDETLLRSKLLYAIECAAGFELS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBE3C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:10 - 1:100
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for UBE3C Antibody - BSA Free

• EC 6.3.2.-
• KIAA0010KIAA10ubiquitin-protein isopeptide ligase (E3)
• ubiquitin protein ligase E3C
• ubiquitin-protein ligase E3C

Background

E3 ubiquitin-protein ligase that accepts ubiquitin from the E2 ubiquitin-conjugating enzyme UBE2D1 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. It can target itself for ubiquitination in vitro and may promote its own degradation in vivo

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBE3C