UBE3B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: UBE3B Antibody [NBP1-92559] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: UBE3B Antibody [NBP1-92559] - Staining of human testis shows strong positivity in cytoplasm in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: UBE3B Antibody [NBP1-92559] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: UBE3B Antibody [NBP1-92559] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: UBE3B Antibody [NBP1-92559] - Staining of human kidney shows strong positivity in cytoplasm in cells in tubules.
Immunohistochemistry-Paraffin: UBE3B Antibody [NBP1-92559] - Staining of human rectum shows strong positivity in cytoplasm in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UBE3B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ANIMGHLNQHGFYSVLQILLTRGLARPRPCLSKGTLTAAFSLALRPVIAAQFSDNLIRPFLIHIMSVPALVTHLSTVTPERLTVLESHDMLRKFIIFLRDQDRCRDV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBE3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID: 29635114).
Control Peptide
UBE3B Protein (NBP1-92559PEP)
Publications
Read Publication using
NBP1-92559 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (85%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UBE3B Antibody

  • DKFZp586K2123
  • DKFZp686A1051
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ45294
  • MGC131858
  • MGC78388
  • ubiquitin protein ligase E3B
  • ubiquitin-protein ligase E3B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1031
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF8516
Species: Hu
Applications: ICC, IP, Simple Western, WB
H00004595-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-25973
Species: Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
NB300-581
Species: Am, Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP3-05769
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
NB110-41539
Species: Mu
Applications: ICC/IF, WB
NB100-96916
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
MAB2476
Species: Hu
Applications: IHC, WB
NBP1-90063
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF7895
Species: Hu
Applications: IHC, WB
NBP1-90274
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-92180
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2009
Species: Hu
Applications: ICC, IHC
NBP1-88584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-12316
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB

Publications for UBE3B Antibody (NBP1-92559)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-Fr.


Filter By Application
IHC-Fr
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for UBE3B Antibody (NBP1-92559) (0)

There are no reviews for UBE3B Antibody (NBP1-92559). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for UBE3B Antibody (NBP1-92559) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBE3B Products

Array NBP1-92559

Bioinformatics Tool for UBE3B Antibody (NBP1-92559)

Discover related pathways, diseases and genes to UBE3B Antibody (NBP1-92559). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBE3B Antibody (NBP1-92559)

Discover more about diseases related to UBE3B Antibody (NBP1-92559).
 

Pathways for UBE3B Antibody (NBP1-92559)

View related products by pathway.

PTMs for UBE3B Antibody (NBP1-92559)

Learn more about PTMs related to UBE3B Antibody (NBP1-92559).

Blogs on UBE3B

There are no specific blogs for UBE3B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBE3B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE3B