UBE3B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: UBE3B Antibody [NBP1-92559] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: UBE3B Antibody [NBP1-92559] - Staining of human testis shows strong positivity in cytoplasm in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: UBE3B Antibody [NBP1-92559] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: UBE3B Antibody [NBP1-92559] - Staining of human cerebral cortex shows strong positivity in neuropil.

Immunohistochemistry-Paraffin: UBE3B Antibody [NBP1-92559] - Staining of human kidney shows strong positivity in cytoplasm in cells in tubules.

Immunohistochemistry-Paraffin: UBE3B Antibody [NBP1-92559] - Staining of human rectum shows strong positivity in cytoplasm in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UBE3B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ANIMGHLNQHGFYSVLQILLTRGLARPRPCLSKGTLTAAFSLALRPVIAAQFSDNLIRPFLIHIMSVPALVTHLSTVTPERLTVLESHDMLRKFIIFLRDQDRCRDV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBE3B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID: 29635114).
• Control Peptide:

  UBE3B Protein (NBP1-92559PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (85%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UBE3B Antibody - BSA Free

• DKFZp586K2123
• DKFZp686A1051
• EC 6.3.2
• EC 6.3.2.-
• FLJ45294
• MGC131858
• MGC78388
• ubiquitin protein ligase E3B
• ubiquitin-protein ligase E3B

Background

UBE3B - ubiquitin protein ligase E3B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for UBE3B Antibody (NBP1-92559)(1)

Publication using NBP1-92559

• Herum KM, Choppe J, Kumar A et al. Gene Expression Profile Associated with Postnatal Development of Pyramidal Neurons in the Human Prefrontal Cortex Implicates Ubiquitin Ligase E3 in the Pathophysiology of Schizophrenia Onset J Psychiatr Res. 2018-07-18 [PMID: 29635114] (IHC-Fr, Human)

Bioinformatics

• Gene Symbol: UBE3B