HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free

Immunohistochemistry-Paraffin: HM74A/PUMA-G/GPR109A/NIACR1 Antibody [NBP1-92180] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

• Reactivity: Hu, Mu, Rt, Bv
• Applications: WB, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HCAR2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated Reported in scientific publication (PMID: 32397071).
  • Western Blot Reported in scientific literature (PMID 25622782).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
• Control Peptide:

  HM74A/PUMA-G/GPR109A/NIACR1 Protein (NBP1-92180PEP)

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 25622782). Use in Mouse reported in scientific literature (PMID:32377164). Use in Bovine reported in scientific literature (PMID: 32397071).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free

• GPR109A
• HCA2
• HCAR2
• HM74A
• hydroxycarboxylic acid receptor 2
• Niacr1
• Nicotinic Acid Receptor
• PUMAG

Background

Nicotinic acid receptors are a group of Gi/Go protein-coupled receptors that are currently divided into GPR81, GPR109Aand GPR109B subtypes. GPR109B receptors originated from a gene duplication of GPR109A and have > 95% homology. Allsubtypes are widely expressed throughout adipose tissue and are found at lower levels on macrophages, neutrophils,Langerhans cells and in the spleen. Nicotinic acid receptors are involved in the inhibition of lipolysis. The humangenes encoding these receptors are located on chromosome 12 (12q24.3)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HM74A/PUMA-G/GPR109A/NIACR1 Antibody (NBP1-92180)(7)

Publications using NBP1-92180

• Yang Y, Pei T, Hu X et al. Dietary vitamin B3 supplementation induces the antitumor immunity against liver cancer via biased GPR109A signaling in myeloid cell Cell Reports Medicine 2024-09-17 [PMID: 39293389]
• Chen J, Lin T, Zhang S et al. Niacin/?-hydroxybutyrate regulates milk fat and milk protein synthesis via the GPR109A/Gi/mTORC1 pathway Food & function 2023-03-20 [PMID: 36866679]
• Lee W, Yu H, Tain Y et al. Vinpocetine Ameliorates Metabolic-Syndrome-Associated Bladder Overactivity in Fructose-Fed Rats by Restoring Succinate-Modulated cAMP Levels and Exerting Anti-Inflammatory Effects in the Bladder Detrusor Muscle Biomedicines 2022-10-26 [PMID: 36359236] (WB, Rat)
• Guo W, Liu J, Li W et al. Niacin Alleviates Dairy Cow Mastitis by Regulating the GPR109A/AMPK/NRF2 Signaling Pathway Int J Mol Sci 2020-05-08 [PMID: 32397071] (KD, WB, IF/IHC, Bovine)
• Sun J, Yuan B, Wu Y et al. Sodium Butyrate Protects N2a Cells against A beta Toxicity In Vitro Mediators of Inflammation 2020-04-15 [PMID: 32377164] (WB, Mouse)
• Wong TP, Chan LK, Leung PS. Involvement of the Niacin Receptor GPR109a in the LocalControl of Glucose Uptake in Small Intestine of Type 2Diabetic Mice. Nutrients 2015-09-15 [PMID: 26371038] (WB, Human)
• Chen L, So WY, Li SY et al. Niacin-induced hyperglycemia is partially mediated via niacin receptor GPR109a in pancreatic islets Mol. Cell. Endocrinol. 2015-01-23 [PMID: 25622782] (WB, Rat)

Bioinformatics

• Gene Symbol: HCAR2
• Entrez:
  • 338442(Human)
• Uniprot:
  • Q8TDS4()