HM74A/PUMA-G/GPR109A/NIACR1 Antibody

Images

 
Immunohistochemistry-Paraffin: HM74A/PUMA-G/GPR109A/NIACR1 Antibody [NBP1-92180] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, Rt, BvSpecies Glossary
Applications WB, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HM74A/PUMA-G/GPR109A/NIACR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HCAR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated -Reported in scientific publication (PMID: 32397071).
  • Western Blot -Reported in scientific literature (PMID 25622782).
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
Control Peptide
HM74A/PUMA-G/GPR109A/NIACR1 Protein (NBP1-92180PEP)
Publications
Read Publications using
NBP1-92180 in the following applications:

  • 1 publication
  • KD
    1 publication
  • WB
    5 publications

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 25622782). Use in Mouse reported in scientific literature (PMID:32377164). Use in Bovine reported in scientific literature (PMID: 32397071).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HM74A/PUMA-G/GPR109A/NIACR1 Antibody

  • GPR109A
  • HCA2
  • HCAR2
  • HM74A
  • hydroxycarboxylic acid receptor 2
  • Niacr1
  • Nicotinic Acid Receptor
  • PUMAG

Background

Nicotinic acid receptors are a group of Gi/Go protein-coupled receptors that are currently divided into GPR81, GPR109Aand GPR109B subtypes. GPR109B receptors originated from a gene duplication of GPR109A and have > 95% homology. Allsubtypes are widely expressed throughout adipose tissue and are found at lower levels on macrophages, neutrophils,Langerhans cells and in the spleen. Nicotinic acid receptors are involved in the inhibition of lipolysis. The humangenes encoding these receptors are located on chromosome 12 (12q24.3)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HM74A/PUMA-G/GPR109A/NIACR1 Antibody (NBP1-92180)(6)

We have publications tested in 4 confirmed species: Human, Mouse, Rat, Bovine.

We have publications tested in 3 applications: IF/IHC, KD, WB.


Filter By Application
IF/IHC
(1)
KD
(1)
WB
(5)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
Rat
(2)
Bovine
(1)
All Species

Reviews for HM74A/PUMA-G/GPR109A/NIACR1 Antibody (NBP1-92180) (0)

There are no reviews for HM74A/PUMA-G/GPR109A/NIACR1 Antibody (NBP1-92180). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HM74A/PUMA-G/GPR109A/NIACR1 Antibody (NBP1-92180) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HM74A/PUMA-G/GPR109A/NIACR1 Products

Research Areas for HM74A/PUMA-G/GPR109A/NIACR1 Antibody (NBP1-92180)

Find related products by research area.

Blogs on HM74A/PUMA-G/GPR109A/NIACR1

There are no specific blogs for HM74A/PUMA-G/GPR109A/NIACR1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HM74A/PUMA-G/GPR109A/NIACR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HCAR2
Entrez
Uniprot