HM74A/PUMA-G/GPR109A/NIACR1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HM74A/PUMA-G/GPR109A/NIACR1 Antibody [NBP1-92180] - Staining of human cell line RT4 shows localization to cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HM74A/PUMA-G/GPR109A/NIACR1 Antibody [NBP1-92180] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HM74A/PUMA-G/GPR109A/NIACR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP
Specificity
Specificity of human HM74A/PUMA-G/GPR109A/NIACR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HCAR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in WB reported in scientific literature (PMID 25622782).
Control Peptide
Publications
Read Publications using
NBP1-92180 in the following applications:

  • WB
    2 publications

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 25622782)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HM74A/PUMA-G/GPR109A/NIACR1 Antibody

  • GPR109A
  • HCA2
  • HCAR2
  • HM74A
  • hydroxycarboxylic acid receptor 2
  • Niacr1
  • Nicotinic Acid Receptor
  • PUMAG

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24488
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00134391-B01P
Species: Hu
Applications: WB, ELISA, Flow
NLS2756
Species: Hu, Mk
Applications: IHC, IHC-P, ICC
NLS2095
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NLS2272
Species: Hu, Mk, Pm
Applications: IHC, IHC-P
NLS1017
Species: Hu, Mu, Bt, Bv, Ca, Eq
Applications: IHC, IHC-P
NLS2576
Species: Hu, Rt, Mk
Applications: IHC, IHC-P
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00005729-B01P
Species: Hu
Applications: WB, Flow
NBP1-00178
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
7270-IL/CF
Species: Hu
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for HM74A/PUMA-G/GPR109A/NIACR1 Antibody (NBP1-92180)(2)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for HM74A/PUMA-G/GPR109A/NIACR1 Antibody (NBP1-92180) (0)

There are no reviews for HM74A/PUMA-G/GPR109A/NIACR1 Antibody (NBP1-92180). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HM74A/PUMA-G/GPR109A/NIACR1 Antibody (NBP1-92180) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HM74A/PUMA-G/GPR109A/NIACR1 Products

Bioinformatics Tool for HM74A/PUMA-G/GPR109A/NIACR1 Antibody (NBP1-92180)

Discover related pathways, diseases and genes to HM74A/PUMA-G/GPR109A/NIACR1 Antibody (NBP1-92180). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HM74A/PUMA-G/GPR109A/NIACR1 Antibody (NBP1-92180)

Discover more about diseases related to HM74A/PUMA-G/GPR109A/NIACR1 Antibody (NBP1-92180).
 

Pathways for HM74A/PUMA-G/GPR109A/NIACR1 Antibody (NBP1-92180)

View related products by pathway.

PTMs for HM74A/PUMA-G/GPR109A/NIACR1 Antibody (NBP1-92180)

Learn more about PTMs related to HM74A/PUMA-G/GPR109A/NIACR1 Antibody (NBP1-92180).

Blogs on HM74A/PUMA-G/GPR109A/NIACR1

There are no specific blogs for HM74A/PUMA-G/GPR109A/NIACR1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HM74A/PUMA-G/GPR109A/NIACR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HCAR2
Entrez
Uniprot