UBE2J1 Antibody

Images

 
Western Blot: UBE2J1 Antibody [NBP1-85654] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: UBE2J1 Antibody [NBP1-85654] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: UBE2J1 Antibody [NBP1-85654] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
Orthogonal Strategies: Immunohistochemistry-Paraffin: UBE2J1 Antibody [NBP1-85654] - Staining in human lymph node and skeletal muscle tissues using anti-UBE2J1 antibody. Corresponding UBE2J1 RNA-seq data are ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

UBE2J1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESDLNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHTD
Specificity
Specificity of human UBE2J1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBE2J1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UBE2J1 Protein (NBP1-85654PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UBE2J1 Antibody

  • CGI-76
  • EC 6.3.2.19
  • HSPC153
  • HSPC205
  • HSU93243
  • HsUBC6e
  • MGC12555
  • NCUBE1
  • NCUBE-1
  • NCUBE1HSUBC6e
  • Non-canonical ubiquitin-conjugating enzyme 1
  • non-canonical ubquitin conjugating enzyme 1
  • UBC6e
  • Ubc6p
  • UBE2J1
  • ubiquitin-conjugating enzyme E2 J1
  • ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast)
  • Yeast ubiquitin-conjugating enzyme UBC6 homolog E

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2265
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-46278
Species: Hu
Applications: WB, IHC, IF
NBP2-13499
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31267
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-89728
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
E2-710
Species: Hu
E2-622
Species: Hu
NBP1-78983
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P
NBP2-54692
Species: Hu
Applications: WB, IHC, IHC-P
E2-616
Species: Hu
NB300-130
Species: Hu, Mu, Rt, Po, Bv, Ce, Ch, Dr, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-448
Species: Hu, Mu, Ca, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85654
Species: Hu
Applications: WB, IHC, IHC-P

Publications for UBE2J1 Antibody (NBP1-85654) (0)

There are no publications for UBE2J1 Antibody (NBP1-85654).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBE2J1 Antibody (NBP1-85654) (0)

There are no reviews for UBE2J1 Antibody (NBP1-85654). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBE2J1 Antibody (NBP1-85654) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBE2J1 Products

Bioinformatics Tool for UBE2J1 Antibody (NBP1-85654)

Discover related pathways, diseases and genes to UBE2J1 Antibody (NBP1-85654). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBE2J1 Antibody (NBP1-85654)

Discover more about diseases related to UBE2J1 Antibody (NBP1-85654).
 

Pathways for UBE2J1 Antibody (NBP1-85654)

View related products by pathway.

PTMs for UBE2J1 Antibody (NBP1-85654)

Learn more about PTMs related to UBE2J1 Antibody (NBP1-85654).

Blogs on UBE2J1

There are no specific blogs for UBE2J1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBE2J1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2J1
Entrez