UBE2J1 Antibody


Western Blot: UBE2J1 Antibody [NBP1-59757] - Titration: 2.5ug/ml Positive Control: Jurkat cell lysate.
Immunohistochemistry: UBE2J1 Antibody [NBP1-59757] - Paraffin Embedded Tissue: Human alveolar cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
Immunohistochemistry: UBE2J1 Antibody [NBP1-59757] - Human kidney
Immunohistochemistry: UBE2J1 Antibody [NBP1-59757] - Human Lung

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

UBE2J1 Antibody Summary

Synthetic peptides corresponding to UBE2J1(ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast)) The peptide sequence was selected from the N terminal of UBE2J1. Peptide sequence METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPD.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against UBE2J1 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UBE2J1 Antibody

  • CGI-76
  • EC
  • HSPC153
  • HSPC205
  • HSU93243
  • HsUBC6e
  • MGC12555
  • NCUBE1
  • NCUBE-1
  • Non-canonical ubiquitin-conjugating enzyme 1
  • non-canonical ubquitin conjugating enzyme 1
  • UBC6e
  • Ubc6p
  • UBE2J1
  • ubiquitin-conjugating enzyme E2 J1
  • ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast)
  • Yeast ubiquitin-conjugating enzyme UBC6 homolog E


The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2J1 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum (ER) and may contribute to quality control ER-associated degradation by the ubiquitin-proteasome system.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum (ER) and may contribute to quality control ER-associated degradation by the ubiquitin-proteasome system.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Species: Hu
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Po, Bv, Ce, Ch, Dr, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Ca, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for UBE2J1 Antibody (NBP1-59757) (0)

There are no publications for UBE2J1 Antibody (NBP1-59757).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBE2J1 Antibody (NBP1-59757) (0)

There are no reviews for UBE2J1 Antibody (NBP1-59757). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBE2J1 Antibody (NBP1-59757) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional UBE2J1 Products

Bioinformatics Tool for UBE2J1 Antibody (NBP1-59757)

Discover related pathways, diseases and genes to UBE2J1 Antibody (NBP1-59757). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBE2J1 Antibody (NBP1-59757)

Discover more about diseases related to UBE2J1 Antibody (NBP1-59757).

Pathways for UBE2J1 Antibody (NBP1-59757)

View related products by pathway.

PTMs for UBE2J1 Antibody (NBP1-59757)

Learn more about PTMs related to UBE2J1 Antibody (NBP1-59757).

Blogs on UBE2J1

There are no specific blogs for UBE2J1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our UBE2J1 Antibody and receive a gift card or discount.


Gene Symbol UBE2J1