Recombinant Human UBASH3B/STS1/Tula-2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human UBASH3B/STS1/Tula-2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 344 - 441 of Human UBASH3B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DGVLERRPYEDQGLGETTPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPI

Protein/Peptide Type
Partial Recombinant Protein
Gene
UBASH3B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UBASH3B/STS1/Tula-2 Protein

  • Cbl-interacting Protein p70
  • Cbl-interacting protein Sts-1
  • KIAA1959SH3 domain-containing 70 kDa protein, suppressor of T-cell receptor signaling1, nm23-phosphorylated unknown substrate
  • MGC15437
  • nm23-phosphorylated unknown substrate
  • p70
  • STS1
  • STS1EC 3.1.3.48
  • STS-1ubiquitin-associated and SH3 domain-containing protein B
  • Suppressor of T-cell receptor signaling 1
  • T-cell ubiquitin ligand 2
  • TULA-2
  • Tyrosine-protein phosphatase STS1/TULA2
  • UBASH3B
  • ubiquitin associated and SH3 domain containing B

Background

This gene encodes a protein that contains a ubiquitin associated domain at the N-terminus, an SH3 domain, and a C-terminal domain with similarities to the catalytic motif of phosphoglycerate mutase. The encoded protein was found to inhibit endocytosis of epidermal growth factor receptor (EGFR) and platelet-derived growth factor receptor. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
409-ML/CF
Species: Mu
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01) (0)

There are no publications for UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01) (0)

There are no reviews for UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UBASH3B/STS1/Tula-2 Products

Bioinformatics Tool for UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01)

Discover related pathways, diseases and genes to UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01)

Discover more about diseases related to UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01).
 

Pathways for UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01)

View related products by pathway.

PTMs for UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01)

Learn more about PTMs related to UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01).

Blogs on UBASH3B/STS1/Tula-2

There are no specific blogs for UBASH3B/STS1/Tula-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UBASH3B/STS1/Tula-2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UBASH3B
Entrez