Home » UBASH3B/STS1/Tula-2 » STS1 Peptides and Proteins » Recombinant Human UBASH3B/STS1/Tula-2 Protein

Recombinant Human UBASH3B/STS1/Tula-2 Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human UBASH3B/STS1/Tula-2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 344-441 of Human UBASH3B/STS1/Tula-2

Source: Wheat Germ

Amino Acid Sequence: DGVLERRPYEDQGLGETTPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPI
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
UBASH3B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UBASH3B/STS1/Tula-2 Protein

  • Cbl-interacting Protein p70
  • Cbl-interacting protein Sts-1
  • KIAA1959SH3 domain-containing 70 kDa protein, suppressor of T-cell receptor signaling1, nm23-phosphorylated unknown substrate
  • MGC15437
  • nm23-phosphorylated unknown substrate
  • p70
  • STS1
  • STS1EC 3.1.3.48
  • STS-1ubiquitin-associated and SH3 domain-containing protein B
  • Suppressor of T-cell receptor signaling 1
  • T-cell ubiquitin ligand 2
  • TULA-2
  • Tyrosine-protein phosphatase STS1/TULA2
  • UBASH3B
  • ubiquitin associated and SH3 domain containing B

Background

This gene encodes a protein that contains a ubiquitin associated domain at the N-terminus, an SH3 domain, and a C-terminal domain with similarities to the catalytic motif of phosphoglycerate mutase. The encoded protein was found to inhibit endocytosis of epidermal growth factor receptor (EGFR) and platelet-derived growth factor receptor. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ribosomal Protein
S6/RPS6 Antibody
NB100-1595
Western Blot: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Detection of Human RPS6 on HeLa whole cell lysate using NB100-1595. RPS6 was also immunoprecipitated using rabbit anti-RPS6 antibodies NB100-1594 and another RPS6 Ab.
Immunohistochemistry: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Sample: FFPE section of human lung carcinoma. Antibody: Affinity purified rabbit anti- RPS6 used at a dilution of 1:200 (1ug/ml). Detection: DAB
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(492 Publications)
Species: Hu
p70 S6 Kinase/S6K
Antibody [Unconjugate ...
AF8962
Western blot shows lysates of MCF‑7 human breast cancer cell line, HeLa human cervical epithelial carcinoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 0.2 µg/mL of Rabbit Anti-Human/Mouse/Rat p70 S6 Kinase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8962) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for p70 S6 Kinase at approximately 70 and 90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
p70 S6 Kinase was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human/Mouse/Rat p70 S6 Kinase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8962) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for p70 S6 Kinase at approximately 66 kDa (as indicated) using 2 µg/mL of Rabbit Anti-Human/Mouse/Rat p70 S6 Kinase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8962). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
TOR/mTOR Antibody
NB100-240
Western Blot: TOR/mTOR Antibody [NB100-240] - Detection of Human mTOR by Western Blot. Samples: Whole cell lysate (50, 15, 5 ug) from HeLa, and (50 ug) 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-mTOR antibody NB100-240 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Western Blot: TOR/mTOR Antibody [NB100-240] - Whole cell lysate from HeLa (5, 15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded) and 293T (T; 50 ug) cells. Affinity purified rabbit anti-mTOR antibody used for WB at 0.4 ug/ml (A) used for IP at 3 ug/mg lysate. mTOR was also immunoprecipitated by a previous lot of this antibody and by rabbit anti-mTOR antibodies NB100-241 and NB100-58821. For blotting immunoprecipitated mTOR, NB100-58821 was used at 1 ug/ml. Detection: Chemiluminescence with exposure times of 30 seconds (A) and 3 minutes (B).
Proximity Ligation Assay: TOR/mTOR Antibody [NB100-240] - Secondary-conjugate Duolink II PLA in Hela cells. goat anti-human RPL26 (NBP2-22233) and rabbit anti-human mTOR (NB100-240). Image merged from DAPI (2ms) and Texas Red (100ms) exposures, 40X magnification.
(5 Publications)
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA, ICC
IL-2 [Unconjugated]
202-IL
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
(11 Reviews)
(228 Publications)
Species: Hu
Tbp7 Antibody
NBP1-87799
Western Blot: Tbp7 Antibody [NBP1-87799] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunocytochemistry/Immunofluorescence: Tbp7 Antibody [NBP1-87799] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Tbp7 Antibody [NBP1-87799] - Staining of human gall bladder shows nuclear positivity in glandular cells.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Akt phosphorylated at S473 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(18 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
IFN-gamma
[Unconjugated]
285-IF
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is 0.15‑0.75 ng/mL.
(5 Reviews)
(244 Publications)
Species: Hu
IL-4 [Unconjugated]
204-IL/CF
1 μg/lane of Recombinant Human IL-4 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human IL-4 (Catalog # 204‑IL/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 0.05‑02 ng/mL.
(279 Publications)
Species: Hu
4EBP1 Antibody
NB200-157
Western Blot: 4EBP1 Antibody [NB200-157] - Whole cell lysate (100 ug) from RINm5F insulinoma exposed to high or low concentration of leucine. Antibody used at 0.25 ug/ml.
Immunohistochemistry: 4EBP1 Antibody [NB200-157] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti-4EBP1 used at a dilution of 1:20,000 ( 0.05ug/ml). Detection: DAB staining using Immunohistochemistry Accessory Kit.
(45 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
Doublecortin
Antibody (3E1)
NBP1-92684
Western Blot: Doublecortin Antibody (3E1) [NBP1-92684] - Analysis of rat whole brain lysates using mouse mAb to Doublecortin (DCX), NBP1-92684, dilution 1:1,000 in green: [1] protein standard (red), [2] adult rat brain, [3] embryonic E20 rat brain. Strong bands at 40, 45kDa correspond to DCX protein, detected only in the developing brain.
Immunocytochemistry/Immunofluorescence: Doublecortin Antibody (3E1) [NBP1-92684] - Analysis of cortical neuron-glial cell culture from E20 rat stained with mouse mAb to Doublecortin (DCX), NBP1-92684, dilution 1:1,000 in red, and costained with chicken pAb to Microtubule Associated Protein2 (MAP2), dilution 1:10,000 in green. The blue is DAPI staining of nuclear DNA. DCX antibody reveals strong cytoplasmic staining in a population of small developing neurons and their processes, while MAP2 antibody stains dendrites and perikarya of mature neurons. Therefore DCX antibody is an excellent marker of developing neuronal cells.
Immunocytochemistry/Immunofluorescence: Doublecortin Antibody (3E1) [NBP1-92684] - Rat brain neural cultures stained with NBP1-92684 (green), a chicken polyclonal antibody to GFAP (NB300-213, red) and DNA (blue). The NBP1-92684 antibody reveals strong cytoplasmic staining in a population of small developing neurons. These cells are often found in small clumps as in these cultures, as in this example. Note that they are not positive for MAP2, which is characteristic of more mature neurons, and that the mature neuron shown is negative for NBP1-92684. This Doublecortin antibody is therefore an excellent marker of developing neuronal cells.
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
IL-9
409-ML/CF
IL-9
(5 Publications)
Species: Mu
PYK2/FAK2 Antibody
(SC06-15)
NBP2-67627
Immunocytochemistry/Immunofluorescence: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Staining PYK2 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Analysis of paraffin-embedded mouse brain tissue using anti-PYK2 antibody. Counter stained with hematoxylin.
Immunocytochemistry/Immunofluorescence: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Staining PYK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
p63/TP73L Antibody
- Azide and BSA Free
NBP2-33090
p63/TP73L Antibody - Azide and BSA Free
(1 Publication)
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
RPSA Antibody
(JF0955)
NBP2-67117
Western Blot: RPSA Antibody (JF0955) [NBP2-67117] - Analysis of RPSA on different lysates using anti-RPSA antibody at 1/1,000 dilution. Positive control: Lane 1: K562 Lane 2: HepG2 Lane 3: A431
Immunocytochemistry/Immunofluorescence: RPSA Antibody (JF0955) [NBP2-67117] - Staining RPSA in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: RPSA Antibody (JF0955) [NBP2-67117] - Analysis of paraffin-embedded mouse kidney tissue using anti-RPSA antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
GEF-H1 Antibody
NBP2-21577
Western Blot: GEF-H1 Antibody [NBP2-21577] - Immunoprecipitation of GEF-H1 protein from 293T whole cell extracts using 5 ug of GEF-H1 antibody. Western blot analysis was performed using GEF-H1 antibody. EasyBlot anti-Rabbit IgG was used as a secondary reagent.
Immunocytochemistry/Immunofluorescence: GEF-H1 Antibody [NBP2-21577] - HeLa cells were fixed in -20C 100% MeOH for 5 min. Green: ARHGEF2 protein stained by GEF-H1 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: GEF-H1 Antibody [NBP2-21577] - Paraffin-embedded mouse testis. GEF-H1 antibody dilution: 1:500.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD

Publications for UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01) (0)

There are no publications for UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01) (0)

There are no reviews for UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UBASH3B/STS1/Tula-2 Products

Bioinformatics Tool for UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01)

Discover related pathways, diseases and genes to UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01)

Discover more about diseases related to UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01).
 

Pathways for UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01)

View related products by pathway.

PTMs for UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01)

Learn more about PTMs related to UBASH3B/STS1/Tula-2 Partial Recombinant Protein (H00084959-Q01).

Blogs on UBASH3B/STS1/Tula-2

There are no specific blogs for UBASH3B/STS1/Tula-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human UBASH3B/STS1/Tula-2 Protein
H00084959-P01-10ug
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
TNF-alpha [Unconjugated]
210-TA-005
Western blot shows lysates of HCT‑116 human colorectal carcinoma cell line, HEK293 human embryonic kidney cell line, MOLT‑4 human acute lymphoblastic leukemia cell line, U‑118‑MG human glioblastoma/astrocytoma cell line, U2OS human osteosarcoma cell line, and Y3‑Ag rat myeloid cell line. PVDF Membrane was probed with 2 µg/mL of Human/Rat UBASH3B/STS1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6696) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for UBASH3B/STS1 at approximately 72 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
UBASH3B/STS1/Tula-2 Antibody
AF6696
1 μg/lane of Recombinant Human IL-4 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UBASH3B/STS1/Tula-2 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol UBASH3B
Entrez