UBA3 Antibody - BSA Free

Immunohistochemistry-Paraffin: UBA3 Antibody [NBP1-83150] - staining of human lateral ventricle shows strong nuclear and additional cytoplasmic positivity in neuronal cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UBA3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UBA3 Antibody - BSA Free (NBP1-83150) is a polyclonal antibody validated for use in IHC. Anti-UBA3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTR
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBA3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  UBA3 Protein (NBP1-83150PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UBA3 Antibody - BSA Free

• DKFZp566J164
• EC 6.3.2
• EC 6.3.2.-
• hUBA3
• MGC22384
• NEDD8-activating enzyme E1 catalytic subunit
• NEDD8-activating enzyme E1C
• Nedd8-activating enzyme hUba3
• UBA3
• UBA3, ubiquitin-activating enzyme E1 homolog
• UBE1C
• Ubiquitin-activating enzyme 3
• ubiquitin-activating enzyme E1C (homologous to yeast UBA3)
• Ubiquitin-activating enzyme E1C
• ubiquitin-like modifier activating enzyme 3
• Ubiquitin-like modifier-activating enzyme 3
• yeast)

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, a ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for UBA3 Antibody (NBP1-83150)(1)

Publication using NBP1-83150

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: UBA3