UBA3 Antibody

Images

 
Immunohistochemistry-Paraffin: UBA3 Antibody [NBP1-83150] - staining of human lateral ventricle shows strong nuclear and additional cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UBA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UBA3 Protein (NBP1-83150PEP)
Publications
Read Publication using NBP1-83150.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UBA3 Antibody

  • DKFZp566J164
  • EC 6.3.2
  • EC 6.3.2.-
  • hUBA3
  • MGC22384
  • NEDD8-activating enzyme E1 catalytic subunit
  • NEDD8-activating enzyme E1C
  • Nedd8-activating enzyme hUba3
  • UBA3
  • UBA3, ubiquitin-activating enzyme E1 homolog
  • UBE1C
  • Ubiquitin-activating enzyme 3
  • ubiquitin-activating enzyme E1C (homologous to yeast UBA3)
  • Ubiquitin-activating enzyme E1C
  • ubiquitin-like modifier activating enzyme 3
  • Ubiquitin-like modifier-activating enzyme 3
  • yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37523
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-92162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-55035
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00143384-B01P
Species: Hu
Applications: WB, ELISA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-22104
Species: Hu, Mu, Rt
Applications: WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for UBA3 Antibody (NBP1-83150)(1)

Reviews for UBA3 Antibody (NBP1-83150) (0)

There are no reviews for UBA3 Antibody (NBP1-83150). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for UBA3 Antibody (NBP1-83150) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBA3 Products

Bioinformatics Tool for UBA3 Antibody (NBP1-83150)

Discover related pathways, diseases and genes to UBA3 Antibody (NBP1-83150). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBA3 Antibody (NBP1-83150)

Discover more about diseases related to UBA3 Antibody (NBP1-83150).
 

Pathways for UBA3 Antibody (NBP1-83150)

View related products by pathway.

PTMs for UBA3 Antibody (NBP1-83150)

Learn more about PTMs related to UBA3 Antibody (NBP1-83150).
 

Research Areas for UBA3 Antibody (NBP1-83150)

Find related products by research area.

Blogs on UBA3

There are no specific blogs for UBA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBA3
Entrez