UACA Antibody - BSA Free

Western Blot: UACA Antibody [NBP1-92554] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: UACA Antibody [NBP1-92554] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UACA Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UACA Antibody - BSA Free (NBP1-92554) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ELNKQLKDLSQKYTEVKNVKEKLVEENAKQTSEILAVQNLLQKQHVPLEQVEALKKSLNGTIENLKEELKSMQRCYEKEQQTVTKLHQLLENQKNSSVPLA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UACA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  UACA Protein (NBP1-92554PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UACA Antibody - BSA Free

• FLJ10128
• KIAA1561MGC141969
• MGC141967
• nuclear membrane binding protein
• NUCLING
• uveal autoantigen with coiled coil domains and ankyrin repeats
• uveal autoantigen with coiled-coil domains and ankyrin repeats

Background

UACA (uveal autoantigen with coiled-coil domains and ankyrin repeats) was originally identified as an autoantigen in patients with panuveitis, a characteristic of Vogt-Koyanagi-Harada disease, and in patients with Graves' disease. UACA was also later identified as Nucling, an mRNA differentially expressed in F9 embryonal carcinoma cells during cardiac muscle differentiation. UACA appears to function as a pro-apoptotic protein that recruits the apaf-1-pro-caspase-9 complex for the induction of apoptosis to mediate the cell-death pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UACA