We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

U2AF2 Recombinant Protein Antigen

Images

 
There are currently no images for U2AF2 Recombinant Protein Antigen (NBP2-58989PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

U2AF2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to U2AF2.

Source: E. coli

Amino Acid Sequence: LTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
U2AF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58989.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for U2AF2 Recombinant Protein Antigen

  • hU2AF(65)
  • hU2AF65
  • splicing factor U2AF 65 kD subunit
  • splicing factor U2AF 65 kDa subunit
  • U2 (RNU2) small nuclear RNA auxiliary factor 2
  • U2 auxiliary factor 65 kDa subunit
  • U2 small nuclear ribonucleoprotein auxiliary factor (65kD)
  • U2 small nuclear RNA auxiliary factor 2
  • U2AF65U2 snRNP auxiliary factor large subunit

Background

U2 auxiliary factor (U2AF), comprised of a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the U2AF large subunit which contains a sequence-specific RNA-binding region with 3 RNA recognition motifs and an Arg/Ser-rich domain necessary for splicing. The large subunit binds to the polypyrimidine tract of introns early during spliceosome assembly. Multiple transcript variants have been detected for this gene, but the full-length natures of only two have been determined to date. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92553
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
H00007536-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-52823
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB5745
Species: Hu
Applications: IHC, WB
NBP1-86125
Species: Hu
Applications: IHC,  IHC-P
H00005725-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Single-Cell Western, WB
NBP2-47291
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-57487
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP3-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-47290
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-13436
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-41367
Species: Hu, Mu, Po, Rt
Applications: IHC,  IHC-P, WB
NBP1-77907
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NBP2-19952
Species: Hu
Applications: ICC/IF, KD, WB
NB100-79848
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-38806
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-58989PEP
Species: Hu
Applications: AC

Publications for U2AF2 Recombinant Protein Antigen (NBP2-58989PEP) (0)

There are no publications for U2AF2 Recombinant Protein Antigen (NBP2-58989PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for U2AF2 Recombinant Protein Antigen (NBP2-58989PEP) (0)

There are no reviews for U2AF2 Recombinant Protein Antigen (NBP2-58989PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for U2AF2 Recombinant Protein Antigen (NBP2-58989PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional U2AF2 Products

Blogs on U2AF2

There are no specific blogs for U2AF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SF3B2 Antibody
NB100-79848

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our U2AF2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol U2AF2