Recombinant Human U2AF2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human U2AF2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 141-240 of Human U2AF2

Source: Wheat Germ

Amino Acid Sequence: GSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
U2AF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human U2AF2 Protein

  • hU2AF(65)
  • hU2AF65
  • splicing factor U2AF 65 kD subunit
  • splicing factor U2AF 65 kDa subunit
  • U2 (RNU2) small nuclear RNA auxiliary factor 2
  • U2 auxiliary factor 65 kDa subunit
  • U2 small nuclear ribonucleoprotein auxiliary factor (65kD)
  • U2 small nuclear RNA auxiliary factor 2
  • U2AF65U2 snRNP auxiliary factor large subunit

Background

U2 auxiliary factor (U2AF), comprised of a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the U2AF large subunit which contains a sequence-specific RNA-binding region with 3 RNA recognition motifs and an Arg/Ser-rich domain necessary for splicing. The large subunit binds to the polypyrimidine tract of introns early during spliceosome assembly. Multiple transcript variants have been detected for this gene, but the full-length natures of only two have been determined to date. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32515
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF6387
Species: Hu
Applications: WB
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-55256
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-57487
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP2-13436
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86191
Species: Hu
Applications: ICC/IF
NB100-2859
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-90821
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-36777
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-51689
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-38806
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00011338-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for U2AF2 Partial Recombinant Protein (H00011338-Q01) (0)

There are no publications for U2AF2 Partial Recombinant Protein (H00011338-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for U2AF2 Partial Recombinant Protein (H00011338-Q01) (0)

There are no reviews for U2AF2 Partial Recombinant Protein (H00011338-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for U2AF2 Partial Recombinant Protein (H00011338-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional U2AF2 Products

Bioinformatics Tool for U2AF2 Partial Recombinant Protein (H00011338-Q01)

Discover related pathways, diseases and genes to U2AF2 Partial Recombinant Protein (H00011338-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for U2AF2 Partial Recombinant Protein (H00011338-Q01)

Discover more about diseases related to U2AF2 Partial Recombinant Protein (H00011338-Q01).
 

Pathways for U2AF2 Partial Recombinant Protein (H00011338-Q01)

View related products by pathway.

PTMs for U2AF2 Partial Recombinant Protein (H00011338-Q01)

Learn more about PTMs related to U2AF2 Partial Recombinant Protein (H00011338-Q01).

Blogs on U2AF2

There are no specific blogs for U2AF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

U2AF2 Antibody
NBP2-33397

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human U2AF2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol U2AF2