TXNL4B Antibody - BSA Free

Images

 
Western Blot: TXNL4B Antibody [NBP2-93577] - Analysis of extracts of mouse liver, using TXNL4B .Exposure time: 90s.
Immunocytochemistry/ Immunofluorescence: TXNL4B Antibody [NBP2-93577] - Immunofluorescence analysis of A-549 cells using TXNL4B antibody (NBP2-93577).

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

TXNL4B Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit TXNL4B Antibody - BSA Free (NBP2-93577) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-149 of human TXNL4B (NP_060323.1). MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TXNL4B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
  • Western Blot 1:500-1:2000
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TXNL4B Antibody - BSA Free

  • Dim1-like protein
  • Dim2
  • DLPthioredoxin-like protein 4B
  • FLJ20511
  • thioredoxin-like 4B

Background

Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G(2) transition

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005498-M01
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, KD, WB
AF009
Species: Hu
Applications: IHC, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
AF4519
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00010907-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP1-84366
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-51575
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-64980
Species: Hu
Applications: Flow, Func, IHC, IHC-Fr,  IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-30659
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB600-1131
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
MAB2965
Species: Hu
Applications: CyTOF-ready, Flow
262-AR
Species: Hu
Applications: BA
AF2364
Species: Hu
Applications: IHC, WB
MAB8306
Species: Hu
Applications: IHC, WB
AF2437
Species: Mu
Applications: IHC, WB
NBP2-93577
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for TXNL4B Antibody (NBP2-93577) (0)

There are no publications for TXNL4B Antibody (NBP2-93577).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TXNL4B Antibody (NBP2-93577) (0)

There are no reviews for TXNL4B Antibody (NBP2-93577). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TXNL4B Antibody (NBP2-93577) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TXNL4B Products

Research Areas for TXNL4B Antibody (NBP2-93577)

Find related products by research area.

Blogs on TXNL4B

There are no specific blogs for TXNL4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TXNL4B Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol TXNL4B