DIMT1L Antibody

Images

 
Western Blot: DIMT1L Antibody [NBP2-30659] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: DIMT1L Antibody [NBP2-30659] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, nucleoli & cytosol.
Immunohistochemistry: DIMT1L Antibody [NBP2-30659] - Staining of human hippocampus shows moderate nucleolar positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DIMT1L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DIMT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Immunofluorescence
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DIMT1L Protein (NBP2-30659PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DIMT1L Antibody

  • 18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase
  • DIM1 dimethyladenosine transferase 1-like (S. cerevisiae)
  • DIM1 dimethyladenosine transferase 1-like
  • DIM1
  • DIMT1dimethyladenosine transferase
  • EC 2.1.1
  • EC 2.1.1.14
  • EC 2.1.1.183,18S rRNA dimethylase
  • HSA9761
  • HUSSY5
  • N'-adenosyl(rRNA) dimethyltransferase
  • probable dimethyladenosine transferase
  • S-adenosylmethionine-6-N'

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00054957-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-32247
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
AF972
Species: Hu
Applications: WB, Simple Western, IHC
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP2-13663
Species: Hu
Applications: IHC, IHC-P
NBP1-86734
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-13429
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82619
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58953
Species: Hu
Applications: ICC/IF

Publications for DIMT1L Antibody (NBP2-30659) (0)

There are no publications for DIMT1L Antibody (NBP2-30659).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIMT1L Antibody (NBP2-30659) (0)

There are no reviews for DIMT1L Antibody (NBP2-30659). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DIMT1L Antibody (NBP2-30659) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DIMT1L Products

Bioinformatics Tool for DIMT1L Antibody (NBP2-30659)

Discover related pathways, diseases and genes to DIMT1L Antibody (NBP2-30659). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DIMT1L

There are no specific blogs for DIMT1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DIMT1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DIMT1
Uniprot