TXNDC5 Antibody

Images

 
Western Blot: TXNDC5 Antibody [NBP2-13497] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: TXNDC5 Antibody [NBP2-13497] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: TXNDC5 Antibody [NBP2-13497] - Staining of human placenta shows cytoplasmic positivity in decidual cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TXNDC5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRT ETGATETVTPSEAPVLAAEPEADKGTVLALTENNFD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TXNDC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:2500-1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TXNDC5 Protein (NBP2-13497PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TXNDC5 Antibody

  • EndoPDI
  • ERp46
  • FLJ90810
  • HCC-2
  • member 15
  • MGC3178
  • PDIA15
  • thioredoxin domain containing 5 (endoplasmic reticulum)
  • thioredoxin domain containing 5
  • thioredoxin domain-containing protein 5
  • thioredoxin related protein
  • TLP46
  • TXNDC5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3241
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB363
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB328
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, Neut, ELISA(Sta)
NBP1-52446
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: WB, ELISA, IHC, IHC-P, ICC
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
AF4538
Species: Hu, Mu, Rt
Applications: WB
MAB145
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-41291
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87766
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB155
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-28640
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC

Publications for TXNDC5 Antibody (NBP2-13497) (0)

There are no publications for TXNDC5 Antibody (NBP2-13497).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TXNDC5 Antibody (NBP2-13497) (0)

There are no reviews for TXNDC5 Antibody (NBP2-13497). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TXNDC5 Antibody (NBP2-13497) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TXNDC5 Products

Bioinformatics Tool for TXNDC5 Antibody (NBP2-13497)

Discover related pathways, diseases and genes to TXNDC5 Antibody (NBP2-13497). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TXNDC5 Antibody (NBP2-13497)

Discover more about diseases related to TXNDC5 Antibody (NBP2-13497).
 

Pathways for TXNDC5 Antibody (NBP2-13497)

View related products by pathway.

PTMs for TXNDC5 Antibody (NBP2-13497)

Learn more about PTMs related to TXNDC5 Antibody (NBP2-13497).
 

Research Areas for TXNDC5 Antibody (NBP2-13497)

Find related products by research area.

Blogs on TXNDC5

There are no specific blogs for TXNDC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TXNDC5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TXNDC5
Entrez