TTLL12 Antibody

Images

 
Western Blot: TTLL12 Antibody [NBP2-88515] - Host: Rabbit. Target Name: TTLL12. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/mlTTLL12 is supported by BioGPS gene expression data to be expressed in HeLa

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TTLL12 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TTLL12. Peptide sequence: PAERSSPGQTPEEGAQALAEFAALHGPALRASGVPERYWGRLLHKLEHEV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TTLL12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TTLL12 Antibody

  • dJ526I14.2
  • KIAA0153FLJ41795
  • tubulin tyrosine ligase-like family, member 12
  • tubulin--tyrosine ligase-like protein 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DKK300
Species: Hu
Applications: ELISA
NB300-917
Species: Hu, Mu
Applications: IF, IHC, IHC-P
MAB6158
Species: Hu, Mu
Applications: ICC, ICFlow, Simple Western, WB
NB100-40845
Species: Hu, Mu
Applications: CHIP-SEQ, ChIP, IHC, IHC-P, IP, KD, WB
NBP2-03288
Species: Hu, Mu, Rt
Applications: WB
AF4036
Species: Hu
Applications: Simple Western, WB
NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NBP2-30676
Species: Hu
Applications: IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB100-1762
Species: Hu, Mu, Pm
Applications: ChIP, ELISA, IHC, IHC-P, Simple Western, WB
NBP1-88719
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-93290
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
H00005324-M02
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, WB
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-41398
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-88515
Species: Hu
Applications: WB

Publications for TTLL12 Antibody (NBP2-88515) (0)

There are no publications for TTLL12 Antibody (NBP2-88515).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTLL12 Antibody (NBP2-88515) (0)

There are no reviews for TTLL12 Antibody (NBP2-88515). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTLL12 Antibody (NBP2-88515) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TTLL12 Products

Bioinformatics Tool for TTLL12 Antibody (NBP2-88515)

Discover related pathways, diseases and genes to TTLL12 Antibody (NBP2-88515). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTLL12 Antibody (NBP2-88515)

Discover more about diseases related to TTLL12 Antibody (NBP2-88515).
 

Pathways for TTLL12 Antibody (NBP2-88515)

View related products by pathway.

PTMs for TTLL12 Antibody (NBP2-88515)

Learn more about PTMs related to TTLL12 Antibody (NBP2-88515).
 

Research Areas for TTLL12 Antibody (NBP2-88515)

Find related products by research area.

Blogs on TTLL12

There are no specific blogs for TTLL12, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTLL12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTLL12