TTBK1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TTBK1 Antibody [NBP2-55410] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TTBK1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LPPQLSQGDGRSETSQPPTPGSPSHSPLHSGPRPRRRESDPTGPQRQVFSVAPPFEVNGLPRAVPLSLPYQDFKRDLSDYRERARLLNRVR
Specificity
Specificity of human TTBK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTBK1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TTBK1 Recombinant Protein Antigen (NBP2-55410PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TTBK1 Antibody

  • BDTK
  • Brain-derived tau kinase
  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA1855tau-tubulin kinase 1
  • RP3-330M21.4
  • tau tubulin kinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
AF7250
Species: Hu
Applications: IHC
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34031
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92564
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31650
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2428
Species: Hu
Applications: WB
NBP2-23485
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB7918
Species: Hu
Applications: WB, Simple Western
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-3588
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NB100-56651
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02673
Species: Hu, Bt, Bv, Ca, Pm, Pm, Rb
Applications: IHC, IHC-P
AF4265
Species: Hu, Mu, Rt
Applications: WB
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-02242
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for TTBK1 Antibody (NBP2-55410) (0)

There are no publications for TTBK1 Antibody (NBP2-55410).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTBK1 Antibody (NBP2-55410) (0)

There are no reviews for TTBK1 Antibody (NBP2-55410). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TTBK1 Antibody (NBP2-55410) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TTBK1 Products

Bioinformatics Tool for TTBK1 Antibody (NBP2-55410)

Discover related pathways, diseases and genes to TTBK1 Antibody (NBP2-55410). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTBK1 Antibody (NBP2-55410)

Discover more about diseases related to TTBK1 Antibody (NBP2-55410).
 

Pathways for TTBK1 Antibody (NBP2-55410)

View related products by pathway.

PTMs for TTBK1 Antibody (NBP2-55410)

Learn more about PTMs related to TTBK1 Antibody (NBP2-55410).
 

Research Areas for TTBK1 Antibody (NBP2-55410)

Find related products by research area.

Blogs on TTBK1

There are no specific blogs for TTBK1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTBK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTBK1