Tsukushi/TSK Antibody

Images

 
Western Blot: Tsukushi/TSK Antibody [NBP1-87959] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: Tsukushi/TSK Antibody [NBP1-87959] - Staining of human cell line A549 shows localization to nucleus.
Immunohistochemistry-Paraffin: Tsukushi/TSK Antibody [NBP1-87959] - Staining of human kidney shows moderate cytoplasmic positivity in tubular cells.
Western Blot: Tsukushi/TSK Antibody [NBP1-87959] - Analysis in human cell line A-549.
Immunocytochemistry/ Immunofluorescence: Tsukushi/TSK Antibody [NBP1-87959] - Staining of human cell line MCF7 shows positivity in nucleus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tsukushi/TSK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DTAHLDLSSNRLEMVNESVLAGPGYTTLAGLDLSHNLLTSISPTAFSRLRYLESLDLSHNGLTALPAESFTSSPLSDVNLSHNQLREVSVSAFTTHSQGRALHVDLSHNLIHR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSKU
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Tsukushi/TSK Protein (NBP1-87959PEP)
Publications
Read Publication using NBP1-87959.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tsukushi/TSK Antibody

  • E2IG4
  • E2IG4E2-induced gene 4 protein
  • leucine rich repeat containing 54
  • Leucine-rich repeat-containing protein 54
  • LRRC54
  • TSK
  • TSKtsukushi homolog
  • TSKU
  • tsukushi small leucine rich proteoglycan homolog (Xenopus laevis)
  • Tsukushi
  • tsukushi, small leucine rich proteoglycan
  • tsukushin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87987
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB110-8146
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NB100-757
Species: Hu
Applications: WB, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Tsukushi/TSK Antibody (NBP1-87959)(1)

Reviews for Tsukushi/TSK Antibody (NBP1-87959) (0)

There are no reviews for Tsukushi/TSK Antibody (NBP1-87959). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Tsukushi/TSK Antibody (NBP1-87959) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tsukushi/TSK Products

Bioinformatics Tool for Tsukushi/TSK Antibody (NBP1-87959)

Discover related pathways, diseases and genes to Tsukushi/TSK Antibody (NBP1-87959). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tsukushi/TSK Antibody (NBP1-87959)

Discover more about diseases related to Tsukushi/TSK Antibody (NBP1-87959).
 

Pathways for Tsukushi/TSK Antibody (NBP1-87959)

View related products by pathway.

Blogs on Tsukushi/TSK

There are no specific blogs for Tsukushi/TSK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tsukushi/TSK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSKU
Entrez