Testin Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Testin Antibody [NBP1-87987] - Staining of human cell line SiHa shows localization to cytosol & focal adhesion sites. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Testin Antibody [NBP1-87987] - Staining of human endometrium, liver, testis and urinary bladder using Anti-TES antibody NBP1-87987 (A) shows similar protein distribution across tissues to independent antibody NBP1-85072 (B).

Immunohistochemistry-Paraffin: Testin Antibody [NBP1-87987] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Testin Antibody [NBP1-87987] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Testin Antibody [NBP1-87987] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Immunohistochemistry-Paraffin: Testin Antibody [NBP1-87987] - Staining of human liver shows no positivity in hepatocytes as expected.

Simple Western: Testin Antibody [NBP1-87987] - Simple Western lane view shows a specific band for TES in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: Testin Antibody [NBP1-87987] - Electropherogram image(s) of corresponding Simple Western lane view. Testin antibody was used at 1:20 dilution on RT-4 lysate(s).

Western Blot: Testin Antibody [NBP1-87987] - Analysis using Anti-TES antibody NBP1-87987 (A) shows similar pattern to independent antibody NBP1-85072 (B).

Analysis in human cell lines A-431 and U-251MG using Anti-TES antibody. Corresponding TES RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

• Reactivity: Hu
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Testin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Testin Antibody - BSA Free (NBP1-87987) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-Testin Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TES
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, separated by Size, antibody dilution of 1:20, apparent MW was 57 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue. Use in IHC-P reported in scientific literature (PMID:34440214).
• Control Peptide:

  Testin Protein (NBP1-87987PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (85%). Reactivity reported in scientific literature (PMID: 23227862)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Testin Antibody - BSA Free

• DKFZp586B2022
• MGC1146
• TESS
• TESS-2
• TESTIN
• testis derived transcript (3 LIM domains)

Background

Cancer-associated chromosomal changes often involve regions containing fragile sites. This gene maps to a commom fragile site on chromosome 7q31.2 designated FRA7G. This gene is similar to mouse Testin, a testosterone-responsive gene encoding a Sertoli cell secretory protein containing three LIM domains. LIM domains are double zinc-finger motifs that mediate protein-protein interactions between transcription factors, cytoskeletal proteins and signaling proteins. Multiple protein isoforms are encoded by transcript variants of this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Testin Antibody (NBP1-87987)(5)

Publications using NBP1-87987

• Ciaputa R, Brambilla E, Dzimira S et al. Immunohistochemical expression of testin protein in testicular tumours in dogs. Theriogenology 2025-03-05 [PMID: 40090235]
• Ciaputa R, Nowak M, Dzimira S et al. Study on the expression of testin in the testes of dogs Journal of Veterinary Research 2023-10-31 [PMID: 38130450] (IHC-P, Canine)
• Popiel-Kopaczyk A, Grzegrzolka J, Piotrowska A et al. The Expression of Testin, Ki-67 and p16 in Cervical Cancer Diagnostics Current issues in molecular biology 2023-01-05 [PMID: 36661518] (IHC-P, Human)
  
  Details:
  Dilution used in IHC-P 1:400
• Popiel A, Piotrowska A, Sputa-Grzegrzolka P Et al. Preliminary Study on the Expression of Testin, p16 and Ki-67 in the Cervical Intraepithelial Neoplasia Biomedicines 2021-08-13 [PMID: 34440214] (IHC-P, Human)
• Danielsson F, Wiking M, Mahdessian D et al. RNA deep sequencing as a tool for selection of cell lines for systematic subcellular localization of all human proteins. J Proteome Res 2013-01-04 [PMID: 23227862]

Bioinformatics

• Gene Symbol: TES