TST Antibody

Images

 
Western Blot: TST Antibody [NBP1-54682] - Jurkat cell lysate, concentration 1 ug/ml.
Immunohistochemistry: TST Antibody [NBP1-54682] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
Immunohistochemistry-Paraffin: TST Antibody [NBP1-54682] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.
Immunohistochemistry: TST Antibody [NBP1-54682] - Analysis of human small intestine after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TST Antibody Summary

Immunogen
Synthetic peptides corresponding to TST(thiosulfate sulfurtransferase (rhodanese)) The peptide sequence was selected from the middle region of TST. Peptide sequence GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TST
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against TST and was validated on Western Blot and immunohistochemistry-P
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TST Antibody

  • EC 2.8.1
  • EC 2.8.1.1
  • MGC19578
  • RDSRhodanese
  • thiosulfate sulfurtransferase (rhodanese)
  • thiosulfate sulfurtransferase

Background

TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.The product of this gene is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The gene product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB300-137
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-16890
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56060
Species: Hu
Applications: ICC/IF
NBP2-67121
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89366
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00030813-R02
Species: Hu
NBP1-82617
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF-249-NA
Species: Hu
Applications: WB, Neut
7770-GT
Species: Hu
NBP2-66139
Species: Hu
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-54682
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TST Antibody (NBP1-54682) (0)

There are no publications for TST Antibody (NBP1-54682).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TST Antibody (NBP1-54682) (0)

There are no reviews for TST Antibody (NBP1-54682). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TST Antibody (NBP1-54682) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TST Antibody (NBP1-54682)

Discover related pathways, diseases and genes to TST Antibody (NBP1-54682). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TST Antibody (NBP1-54682)

Discover more about diseases related to TST Antibody (NBP1-54682).
 

Pathways for TST Antibody (NBP1-54682)

View related products by pathway.

PTMs for TST Antibody (NBP1-54682)

Learn more about PTMs related to TST Antibody (NBP1-54682).

Blogs on TST

There are no specific blogs for TST, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TST Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TST
Uniprot