HSP10/EPF Antibody (0H0X6)

Images

 
Western Blot: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Western blot analysis of extracts of various cell lines, using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at 1:1000 dilution. Secondary antibody: HRP Goat ...read more
Immunocytochemistry/ Immunofluorescence: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunofluorescence analysis of NIH-3T3 cells using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens). Blue: ...read more
Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded mouse kidney using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens).Perform ...read more
Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded rat brain using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens).Perform ...read more
Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded human colon using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens).Perform ...read more
Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded human placenta using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
0H0X6
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HSP10/EPF Antibody (0H0X6) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human HSP10/EPF (P61604). GSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
HSPE1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 0.05% BSA, 50% glycerol, pH7.3
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HSP10/EPF Antibody (0H0X6)

  • 10 kDa chaperonin
  • 10 kDa heat shock protein, mitochondrial
  • Chaperonin 10 Homolog
  • Chaperonin 10
  • CPN10HSP10
  • Early-pregnancy factor
  • EPF
  • GroES
  • heat shock 10kD protein 1 (chaperonin 10)
  • heat shock 10kDa protein 1 (chaperonin 10)
  • HSP10
  • HSPE1

Background

Hsp10 make up a family of small heat shock proteins with an approximate molecular mass of 10 kDa (Hsp10s). Also known as Cpn10, Hsp10 acts as a co-chaperone and interacts with members of the Hsp60 family (GroEL in E. coli) to promote proper folding of polypeptides. In chlamydia, Hsp10 is thought to interact with cHsp60, a reported immunopathological antigen, identifying Hsp10 as a potential contributor to an immunological response.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP1-87148
Species: Hu
Applications: IHC, IHC-P, WB
H00010049-M01
Species: Hu
Applications: ELISA, ICC/IF (-), IHC, WB
NBP2-02996
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-89559
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-05078
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89557
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
H00001719-M01
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-57960
Species: Hu
Applications: IHC, IHC-P, WB
NB600-717
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP3-16604
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for HSP10/EPF Antibody (NBP3-16604) (0)

There are no publications for HSP10/EPF Antibody (NBP3-16604).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSP10/EPF Antibody (NBP3-16604) (0)

There are no reviews for HSP10/EPF Antibody (NBP3-16604). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HSP10/EPF Antibody (NBP3-16604) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSP10/EPF Antibody (0H0X6) and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPE1