TSSC3 Antibody - BSA Free

Western Blot: TSSC3 Antibody [NBP1-59088] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Immunohistochemistry-Paraffin: TSSC3 Antibody [NBP1-59088] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic and membrane

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TSSC3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PHLDA2(pleckstrin homology-like domain, family A, member 2) The peptide sequence was selected from the middle region of PHLDA2. Peptide sequence QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PHLDA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TSSC3 Antibody - BSA Free

• Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein
• BWR1Cp17-Beckwith-Wiedemann region 1 C
• HLDA2BRW1C
• Imprinted in placenta and liver protein
• IPLp17-BWR1C
• pleckstrin homology-like domain family A member 2
• pleckstrin homology-like domain, family A, member 2
• TSSC3p17-Beckwith-Wiedemann region 1C
• tumor suppressing subchromosomal transferable fragment cDNA 3
• tumor suppressing subtransferable candidate 3
• Tumor-suppressing STF cDNA 3 protein
• Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein
• tumor-supressing STF cDNA 3

Background

This gene is one of several genes in the imprinted gene domain of 11p15.5 which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TSSC3 Antibody (NBP1-59088)(1)

Publication using NBP1-59088

• Yan GN, Tang XF, Zhang XC et al. TSSC3 represses self-renewal of osteosarcoma stem cells and Nanog expression by inhibiting the Src/Akt pathway Oncotarget 2017-10-17 [PMID: 29156746] (WB, Human)

Bioinformatics

• Gene Symbol: PHLDA2
• Uniprot:
  • Q53GA4(Human)