TSSC3 Antibody

Images

 
Western Blot: TSSC3 Antibody [NBP1-59088] - HT1080 cell lysate, concentration 0.2-1 ug/ml.
Immunocytochemistry/ Immunofluorescence: TSSC3 Antibody [NBP1-59088] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic and membrane

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSSC3 Antibody Summary

Immunogen
Synthetic peptides corresponding to PHLDA2(pleckstrin homology-like domain, family A, member 2) The peptide sequence was selected from the middle region of PHLDA2. Peptide sequence QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHLDA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against PHLDA2 and was validated on Western blot.
Publications
Read Publication using
NBP1-59088 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TSSC3 Antibody

  • Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein
  • BWR1Cp17-Beckwith-Wiedemann region 1 C
  • HLDA2BRW1C
  • Imprinted in placenta and liver protein
  • IPLp17-BWR1C
  • pleckstrin homology-like domain family A member 2
  • pleckstrin homology-like domain, family A, member 2
  • TSSC3p17-Beckwith-Wiedemann region 1C
  • tumor suppressing subchromosomal transferable fragment cDNA 3
  • tumor suppressing subtransferable candidate 3
  • Tumor-suppressing STF cDNA 3 protein
  • Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein
  • tumor-supressing STF cDNA 3

Background

This gene is one of several genes in the imprinted gene domain of 11p15.5 which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00064396-P01
Species: Hu
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP1-30052
Species: Hu, Mu, Rt, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt
NBP2-56316
Species: Hu
Applications: IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12897
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP2-13306
Species: Hu
Applications: WB, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NB300-131
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for TSSC3 Antibody (NBP1-59088)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TSSC3 Antibody (NBP1-59088) (0)

There are no reviews for TSSC3 Antibody (NBP1-59088). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TSSC3 Antibody (NBP1-59088) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TSSC3 Products

Bioinformatics Tool for TSSC3 Antibody (NBP1-59088)

Discover related pathways, diseases and genes to TSSC3 Antibody (NBP1-59088). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSSC3 Antibody (NBP1-59088)

Discover more about diseases related to TSSC3 Antibody (NBP1-59088).
 

Pathways for TSSC3 Antibody (NBP1-59088)

View related products by pathway.

PTMs for TSSC3 Antibody (NBP1-59088)

Learn more about PTMs related to TSSC3 Antibody (NBP1-59088).
 

Research Areas for TSSC3 Antibody (NBP1-59088)

Find related products by research area.

Blogs on TSSC3

There are no specific blogs for TSSC3, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSSC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHLDA2
Uniprot
COVID-19 update