TSPYL5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TSPYL5 Antibody [NBP1-93578] - Immunofluorescent staining of human cell line A549 shows localization to cytosol & the Golgi apparatus.

Immunohistochemistry-Paraffin: TSPYL5 Antibody [NBP1-93578] - Staining in human testis and placenta tissues using anti-TSPYL5 antibody. Corresponding TSPYL5 RNA-seq data are presented for the same tissues.

Immunohistochemistry: TSPYL5 Antibody [NBP1-93578] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.

Immunohistochemistry-Paraffin: TSPYL5 Antibody [NBP1-93578] - Staining of human placenta shows low expression as expected.

Immunohistochemistry-Paraffin: TSPYL5 Antibody [NBP1-93578] - Staining of human testis shows high expression.

Staining of human placenta shows no positivity in trophoblastic cells as expected.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human testis shows strong cytoplasmic positivity in spermatogonia.

Analysis in human testis and liver tissues using NBP1-93578 antibody. Corresponding TSPYL5 RNA-seq data are presented for the same tissues.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TSPYL5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TSPYL5 Antibody - BSA Free (NBP1-93578) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SQEKEVLSYLNSLEVEELGLARLGYKIKFYFDRNPYFQNKVLIKEYGCGPSGQVVSRSTPIQWLPGHDLQSLSQGNPENNRSFFGWFSNHSSIESDKIVEIINEELWPNPLQFYLLSEGARV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSPYL5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TSPYL5 Protein (NBP1-93578PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TSPYL5 Antibody - BSA Free

• KIAA1750
• testis-specific Y-encoded-like protein 5
• TSPY-like 5
• TSPY-like protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSPYL5