ZIK1 Antibody


Immunocytochemistry/ Immunofluorescence: ZIK1 Antibody [NBP2-32507] - Immunofluorescent staining of human cell line HEK 293 shows localization to intermediate filaments.
Immunohistochemistry-Paraffin: ZIK1 Antibody [NBP2-32507] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ZIK1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: CMSLKPFRKWEVGKDLPAMLRLLRSLVFPGGKKPGTITECGEDIRSQKSHYKSGECGKASRH
Specificity of human ZIK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZIK1 Protein (NBP2-32507PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZIK1 Antibody

  • MGC119699
  • MGC119700
  • Zinc finger protein 762
  • zinc finger protein interacting with K protein 1 homolog (mouse)
  • zinc finger protein interacting with ribonucleoprotein K
  • ZNF762MGC119701


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, ICC/IF, IHC, ELISA(Cap)
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZIK1 Antibody (NBP2-32507) (0)

There are no publications for ZIK1 Antibody (NBP2-32507).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZIK1 Antibody (NBP2-32507) (0)

There are no reviews for ZIK1 Antibody (NBP2-32507). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZIK1 Antibody (NBP2-32507) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZIK1 Products

Bioinformatics Tool for ZIK1 Antibody (NBP2-32507)

Discover related pathways, diseases and genes to ZIK1 Antibody (NBP2-32507). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZIK1 Antibody (NBP2-32507)

Discover more about diseases related to ZIK1 Antibody (NBP2-32507).

Pathways for ZIK1 Antibody (NBP2-32507)

View related products by pathway.

PTMs for ZIK1 Antibody (NBP2-32507)

Learn more about PTMs related to ZIK1 Antibody (NBP2-32507).

Blogs on ZIK1

There are no specific blogs for ZIK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZIK1 Antibody and receive a gift card or discount.


Gene Symbol ZIK1