We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Tryptophan Hydroxylase 1/TPH-1 Recombinant Protein Antigen

Images

 
There are currently no images for Tryptophan Hydroxylase 1/TPH-1 Protein (NBP1-86922PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Tryptophan Hydroxylase 1/TPH-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TPH1.

Source: E. coli

Amino Acid Sequence: ISELKHALSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TPH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86922.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Tryptophan Hydroxylase 1/TPH-1 Recombinant Protein Antigen

  • EC 1.14.16
  • EC 1.14.16.4
  • indoleacetic acid-5-hydroxylase
  • L-tryptophan hydroxylase
  • MGC119994
  • TPH
  • TPH-1
  • TPRH
  • TRPH
  • tryptophan 5-hydroxylase 1
  • Tryptophan 5-monooxygenase 1
  • tryptophan hydroxylase (tryptophan 5-monooxygenase)
  • Tryptophan Hydroxylase 1

Background

Tryptophan hydroxylase (TPH) is the rate-limiting enzyme in the biosynthesis of serotonin (5-HT) and might be related to the pathogenesis of major depression (MD). Two isoforms are known, TPH1 and TPH2. (1). TPH1 is phosphorylated by cAMP-dependent protein kinase A (2). Recently, it has been shown that expression of the TPH1 gene is increased in lungs and pulmonary endothelial cells from patients with idiopathic pulmonary arterial hypertension. Results indicate that TPH1 and peripheral serotonin play an essential role in the development of hypoxia-induced elevations in pulmonary pressures and hypoxia-induced pulmonary vascular remodeling. In addition, the results suggest that, in mice, serotonin has differential effects on the pulmonary vasculature and right ventricular hypertrophy (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74555
Species: Hu, Mu, Pm, Rb, Rt
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
H00006532-D01P
Species: Hu, Mu
Applications: WB
H00006999-B01P
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP2-38868
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80917
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-15954
Species: Hu, Rt
Applications: IHC,  IHC-P, KO, WB
NBP2-26091
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA
NBP2-21590
Species: Hu, Mu
Applications: ICC/IF, Simple Western, WB
NBP3-48256
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
AF3564
Applications: ICC, IHC, IP, WB
NBP3-48739
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DBD00
Applications: ELISA
MAB5764
Applications: CyTOF-ready, Flow, IHC
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP2-92663
Species: Hu, Mu
Applications: WB
AF1445
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NBP1-86922PEP
Species: Hu
Applications: AC

Publications for Tryptophan Hydroxylase 1/TPH-1 Protein (NBP1-86922PEP) (0)

There are no publications for Tryptophan Hydroxylase 1/TPH-1 Protein (NBP1-86922PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tryptophan Hydroxylase 1/TPH-1 Protein (NBP1-86922PEP) (0)

There are no reviews for Tryptophan Hydroxylase 1/TPH-1 Protein (NBP1-86922PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tryptophan Hydroxylase 1/TPH-1 Protein (NBP1-86922PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tryptophan Hydroxylase 1/TPH-1 Products

Research Areas for Tryptophan Hydroxylase 1/TPH-1 Protein (NBP1-86922PEP)

Find related products by research area.

Blogs on Tryptophan Hydroxylase 1/TPH-1

There are no specific blogs for Tryptophan Hydroxylase 1/TPH-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Tryptophan Hydroxylase 1/TPH-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TPH1