We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Tryptase gamma-1/TPSG1 Recombinant Protein Antigen

Images

 
There are currently no images for Tryptase gamma-1/TPSG1 Recombinant Protein Antigen (NBP2-37977PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Tryptase gamma-1/TPSG1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TPSG1.

Source: E. coli

Amino Acid Sequence: PYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCAR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TPSG1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-37977.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Tryptase gamma-1/TPSG1 Recombinant Protein Antigen

  • EC 3.4.21
  • EC 3.4.21.-
  • gamma I
  • gamma II
  • lung tryptase
  • mast cell protease II
  • mast cell tryptase
  • PRSS31skin tryptase
  • Serine protease 31
  • TMTpituitary tryptase
  • TPSG1
  • Transmembrane tryptase
  • trpA
  • tryptase gamma 1
  • tryptase gamma I
  • tryptase gamma II
  • tryptase gamma
  • Tryptase gamma1
  • Tryptase gamma-1

Background

Mast cells contain a number of preformed chemical mediators such as histamine, chymase, carboxypeptidase and proteolytic tryptase. Human Mast Cell Tryptase is considered to be an important marker of mast cell activation as well as an important mediator of inflammation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26444
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, mIF, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
MAB4099
Species: Hu
Applications: ELISA, IP, WB
NBP2-32906
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-16555
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
375-TL
Species: Hu
Applications: BA
NBP2-33778
Species: Hu
Applications: IHC,  IHC-P, WB
255-SC
Species: Hu
Applications: BA
NBP2-92789
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB9167
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
AF3667
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
NBP1-81746
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-37977PEP
Species: Hu
Applications: AC

Publications for Tryptase gamma-1/TPSG1 Recombinant Protein Antigen (NBP2-37977PEP) (0)

There are no publications for Tryptase gamma-1/TPSG1 Recombinant Protein Antigen (NBP2-37977PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tryptase gamma-1/TPSG1 Recombinant Protein Antigen (NBP2-37977PEP) (0)

There are no reviews for Tryptase gamma-1/TPSG1 Recombinant Protein Antigen (NBP2-37977PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tryptase gamma-1/TPSG1 Recombinant Protein Antigen (NBP2-37977PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tryptase gamma-1/TPSG1 Products

Blogs on Tryptase gamma-1/TPSG1

There are no specific blogs for Tryptase gamma-1/TPSG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Tryptase gamma-1/TPSG1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TPSG1