Immunohistochemistry-Paraffin: Tryptase beta-2/TPSB2 Antibody [NBP2-33551] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: Tryptase beta-2/TPSB2 Antibody [NBP2-33551] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Tryptase beta-2/TPSB2 Antibody [NBP2-33551] - Staining of human gastrointestinal shows strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Tryptase beta-2/TPSB2 Antibody [NBP2-33551] - Staining of human lymphoid tissues shows strong cytoplasmic positivity in non-germinal center cells.
Novus Biologicals Rabbit Tryptase beta-2/TPSB2 Antibody - BSA Free (NBP2-33551) is a polyclonal antibody validated for use in IHC. Anti-Tryptase beta-2/TPSB2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VKVPIMENHICDAKYHLGAYTGDDVRIVRD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPSB2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for Tryptase beta-2/TPSB2 Antibody - BSA Free
EC 3.4.21
EC 3.4.21.59
mast cell tryptase beta II
mast cell tryptase beta III
TPS2
TPS2tryptase beta-2
TPSB2
Tryptase alpha/beta-1
tryptase beta 2 (gene/pseudogene)
tryptase beta 2
tryptase beta II
tryptase beta III
Tryptase beta2
Tryptase beta-2
Tryptase II
tryptase III
tryptase-2
tryptaseB
tryptaseC
Tryptase-C
Background
Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. The alleles of this gene exhibit an unusual amount of sequence variation, such that the alleles were once thought to represent two separate genes, beta II and beta III. Beta tryptases appear to be the main isoenzymes expressed in mast cells, whereas in basophils, alpha-tryptases predominate. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Tryptase beta-2/TPSB2 Antibody (NBP2-33551) (0)
There are no reviews for Tryptase beta-2/TPSB2 Antibody (NBP2-33551).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Tryptase beta-2/TPSB2 Antibody - BSA Free and receive a gift card or discount.