Tryptase beta-2/TPSB2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Tryptase beta-2/TPSB2 Antibody [NBP2-33551] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: Tryptase beta-2/TPSB2 Antibody [NBP2-33551] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: Tryptase beta-2/TPSB2 Antibody [NBP2-33551] - Staining of human gastrointestinal shows strong cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: Tryptase beta-2/TPSB2 Antibody [NBP2-33551] - Staining of human lymphoid tissues shows strong cytoplasmic positivity in non-germinal center cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Tryptase beta-2/TPSB2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VKVPIMENHICDAKYHLGAYTGDDVRIVRD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TPSB2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Tryptase beta-2/TPSB2 Recombinant Protein Antigen (NBP2-33551PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Tryptase beta-2/TPSB2 Antibody - BSA Free

• EC 3.4.21
• EC 3.4.21.59
• mast cell tryptase beta II
• mast cell tryptase beta III
• TPS2
• TPS2tryptase beta-2
• TPSB2
• Tryptase alpha/beta-1
• tryptase beta 2 (gene/pseudogene)
• tryptase beta 2
• tryptase beta II
• tryptase beta III
• Tryptase beta2
• Tryptase beta-2
• Tryptase II
• tryptase III
• tryptase-2
• tryptaseB
• tryptaseC
• Tryptase-C

Background

Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. The alleles of this gene exhibit an unusual amount of sequence variation, such that the alleles were once thought to represent two separate genes, beta II and beta III. Beta tryptases appear to be the main isoenzymes expressed in mast cells, whereas in basophils, alpha-tryptases predominate. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Tryptase beta-2/TPSB2 Antibody (NBP2-33551)(1)

Publication using NBP2-33551

• Zhu J, Fan Y, Xiong Y et al. Delineating the dynamic evolution from preneoplasia to invasive lung adenocarcinoma by integrating single-cell RNA sequencing and spatial transcriptomics Experimental & molecular medicine 2022-11-25 [PMID: 36434043] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: TPSB2
• Uniprot:
  • P20231()