Tryptase beta-2/TPSB2 Antibody

Images

 
Western Blot: Tryptase beta-2/TPSB2 Antibody [NBP2-33551] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Lung tissue
Immunohistochemistry-Paraffin: Tryptase beta-2/TPSB2 Antibody [NBP2-33551] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: Tryptase beta-2/TPSB2 Antibody [NBP2-33551] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Tryptase beta-2/TPSB2 Antibody [NBP2-33551] - Staining of human gastrointestinal shows strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Tryptase beta-2/TPSB2 Antibody [NBP2-33551] - Staining of human lymphoid tissues shows strong cytoplasmic positivity in non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tryptase beta-2/TPSB2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VKVPIMENHICDAKYHLGAYTGDDVRIVRD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPSB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TPSAB1 Protein (NBP2-33551PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tryptase beta-2/TPSB2 Antibody

  • EC 3.4.21
  • EC 3.4.21.59
  • mast cell tryptase beta II
  • mast cell tryptase beta III
  • TPS2
  • TPS2tryptase beta-2
  • TPSB2
  • tryptase beta 2 (gene/pseudogene)
  • tryptase beta 2
  • tryptase beta II
  • tryptase beta III
  • Tryptase beta2
  • Tryptase beta-2
  • Tryptase II
  • tryptase III
  • tryptase-2
  • tryptaseB
  • tryptaseC
  • Tryptase-C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26444
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
NB100-108
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82756
Species: Hu
Applications: IHC, IHC-P
NBP1-87411
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NBP1-86644
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF4599
Species: Hu
Applications: IHC, IP, Simple Western, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-01679
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-58358
Species: Ca, Dr, Hu, Mu, Rt, Ze
Applications: ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
NBP2-31981
Species: Hu
Applications: IHC, IHC-P
NBP1-84020
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-45693
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-50579
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Pm, Rb, Rt, Sh, Xp, Ze
Applications: IHC, IHC-P, PEP-ELISA, WB
NB100-56176
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB

Publications for Tryptase beta-2/TPSB2 Antibody (NBP2-33551) (0)

There are no publications for Tryptase beta-2/TPSB2 Antibody (NBP2-33551).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tryptase beta-2/TPSB2 Antibody (NBP2-33551) (0)

There are no reviews for Tryptase beta-2/TPSB2 Antibody (NBP2-33551). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tryptase beta-2/TPSB2 Antibody (NBP2-33551) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Tryptase beta-2/TPSB2 Products

Bioinformatics Tool for Tryptase beta-2/TPSB2 Antibody (NBP2-33551)

Discover related pathways, diseases and genes to Tryptase beta-2/TPSB2 Antibody (NBP2-33551). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tryptase beta-2/TPSB2 Antibody (NBP2-33551)

Discover more about diseases related to Tryptase beta-2/TPSB2 Antibody (NBP2-33551).
 

Pathways for Tryptase beta-2/TPSB2 Antibody (NBP2-33551)

View related products by pathway.

PTMs for Tryptase beta-2/TPSB2 Antibody (NBP2-33551)

Learn more about PTMs related to Tryptase beta-2/TPSB2 Antibody (NBP2-33551).

Blogs on Tryptase beta-2/TPSB2

There are no specific blogs for Tryptase beta-2/TPSB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tryptase beta-2/TPSB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPSB2
Uniprot