TRPV6 Antibody

Images

 
Western Blot: TRPV6 Antibody [NBP1-74138] - Sample Type: hRetinal pigment epithelial cells, 4 individual donors (20ug) Primary Dilution: 1:1000 Secondary Antibody: goat anti-rabbit-AP Secondary Dilution: 1:2000 Image ...read more
Immunocytochemistry/ Immunofluorescence: TRPV6 Antibody [NBP1-74138] - hRetinal pigment epithelial cells Green: primary Red: nuclear Primary Dilution: 1:200 Secondary Antibody: goat anti-rabbit-Alexa 488 Secondary ...read more
Western Blot: TRPV6 Antibody [NBP1-74138] - Rat Brain Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRPV6 Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of Trpv6. Immunizing peptide sequence TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRPV6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against Trpv6 and was validated on Western blot.
Theoretical MW
83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TRPV6 Antibody

  • ABP/ZF
  • calcium channel CaT1
  • Calcium transport protein 1
  • CaT1
  • CATL
  • CaT-L
  • CaT-like
  • ECAC2
  • ECAC2caT-L
  • epithelial apical membrane calcium transporter/channel CaT1
  • Epithelial calcium channel 2Alu-binding protein with zinc finger domain
  • HSA277909
  • LP6728
  • transient receptor potential cation channel subfamily V member 6
  • transient receptor potential cation channel, subfamily V, member 6
  • TRPV6
  • ZFAB

Background

Trpv6 is a Ca(2+)-sensing Ca(2+) channel.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-58924
Species: Hu
Applications: ICC/IF
H00009815-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29942
Species: Hu, Rt
Applications: WB, Flow, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-78911
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF3320
Species: Hu
Applications: WB, IHC
NBP2-35216
Species: Hu
NBP1-85495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-56483
Species: Hu
Applications: ICC/IF
NB110-74960
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC

Publications for TRPV6 Antibody (NBP1-74138) (0)

There are no publications for TRPV6 Antibody (NBP1-74138).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRPV6 Antibody (NBP1-74138) (0)

There are no reviews for TRPV6 Antibody (NBP1-74138). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRPV6 Antibody (NBP1-74138). (Showing 1 - 1 of 1 FAQ).

  1. What are the recommended dilutions for Western blot?
    • I have found that the following conditions have been successfully used with this antibody (generated a good image): Primary dilution: 1:1000, Secondary dilution: 1:2000 of goat anti-rabbit alkaline phosphatase conjugate. This would be a good starting point to try, but we suggest that you optimize the conditions for your particular experiment.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TRPV6 Antibody (NBP1-74138)

Discover related pathways, diseases and genes to TRPV6 Antibody (NBP1-74138). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRPV6 Antibody (NBP1-74138)

Discover more about diseases related to TRPV6 Antibody (NBP1-74138).
 

Pathways for TRPV6 Antibody (NBP1-74138)

View related products by pathway.

PTMs for TRPV6 Antibody (NBP1-74138)

Learn more about PTMs related to TRPV6 Antibody (NBP1-74138).

Blogs on TRPV6.

Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRPV6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPV6
Entrez
Uniprot