TRPV6 Antibody

Western Blot: TRPV6 Antibody [NBP1-74138] - Sample Type: hRetinal pigment epithelial cells, 4 individual donors (20ug) Primary Dilution: 1:1000 Secondary Antibody: goat anti-rabbit-AP Secondary Dilution: 1:2000 Image Submitted by: Brian Kennedy Indiana University Northwest

Western Blot: TRPV6 Antibody [NBP1-74138] - Rat Brain Lysate 1ug/ml Gel Concentration 12%

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Concentration: 0.5 mg/ml

TRPV6 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to the middle region of Trpv6. Immunizing peptide sequence TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRPV6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 83 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TRPV6 Antibody

• ABP/ZF
• calcium channel CaT1
• Calcium transport protein 1
• CaT1
• CATL
• CaT-L
• CaT-like
• ECAC2
• ECAC2caT-L
• epithelial apical membrane calcium transporter/channel CaT1
• Epithelial calcium channel 2Alu-binding protein with zinc finger domain
• HSA277909
• LP6728
• transient receptor potential cation channel subfamily V member 6
• transient receptor potential cation channel, subfamily V, member 6
• TRPV6
• ZFAB

Background

Trpv6 is a Ca(2+)-sensing Ca(2+) channel.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for TRPV6 Antibody (NBP1-74138). (Showing 1 - 1 of 1 FAQ).

1. What are the recommended dilutions for Western blot?
   • I have found that the following conditions have been successfully used with this antibody (generated a good image): Primary dilution: 1:1000, Secondary dilution: 1:2000 of goat anti-rabbit alkaline phosphatase conjugate. This would be a good starting point to try, but we suggest that you optimize the conditions for your particular experiment.

Bioinformatics

• Gene Symbol: TRPV6
• Uniprot:
  • Q9R186(Rat)