TRPV6 Antibody


Western Blot: TRPV6 Antibody [NBP1-74138] - Sample Type: hRetinal pigment epithelial cells, 4 individual donors (20ug) Primary Dilution: 1:1000 Secondary Antibody: goat anti-rabbit-AP Secondary Dilution: 1:2000 Image more
Immunocytochemistry/ Immunofluorescence: TRPV6 Antibody [NBP1-74138] - hRetinal pigment epithelial cells Green: primary Red: nuclear Primary Dilution: 1:200 Secondary Antibody: goat anti-rabbit-Alexa 488 Secondary more
Western Blot: TRPV6 Antibody [NBP1-74138] - Rat Brain Lysate 1ug/ml Gel Concentration 12%

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC

Order Details

TRPV6 Antibody Summary

Synthetic peptides corresponding to the middle region of Trpv6. Immunizing peptide sequence TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against Trpv6 and was validated on Western blot.
Theoretical MW
83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TRPV6 Antibody

  • ABP/ZF
  • calcium channel CaT1
  • Calcium transport protein 1
  • CaT1
  • CATL
  • CaT-L
  • CaT-like
  • ECAC2
  • ECAC2caT-L
  • epithelial apical membrane calcium transporter/channel CaT1
  • Epithelial calcium channel 2Alu-binding protein with zinc finger domain
  • HSA277909
  • LP6728
  • transient receptor potential cation channel subfamily V member 6
  • transient receptor potential cation channel, subfamily V, member 6
  • TRPV6
  • ZFAB


Trpv6 is a Ca(2+)-sensing Ca(2+) channel.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IP, DirELISA
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC

Publications for TRPV6 Antibody (NBP1-74138) (0)

There are no publications for TRPV6 Antibody (NBP1-74138).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRPV6 Antibody (NBP1-74138) (0)

There are no reviews for TRPV6 Antibody (NBP1-74138). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRPV6 Antibody (NBP1-74138). (Showing 1 - 1 of 1 FAQ).

  1. What are the recommended dilutions for Western blot?
    • I have found that the following conditions have been successfully used with this antibody (generated a good image): Primary dilution: 1:1000, Secondary dilution: 1:2000 of goat anti-rabbit alkaline phosphatase conjugate. This would be a good starting point to try, but we suggest that you optimize the conditions for your particular experiment.

Secondary Antibodies


Isotype Controls

Additional TRPV6 Products

Bioinformatics Tool for TRPV6 Antibody (NBP1-74138)

Discover related pathways, diseases and genes to TRPV6 Antibody (NBP1-74138). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRPV6 Antibody (NBP1-74138)

Discover more about diseases related to TRPV6 Antibody (NBP1-74138).

Pathways for TRPV6 Antibody (NBP1-74138)

View related products by pathway.

PTMs for TRPV6 Antibody (NBP1-74138)

Learn more about PTMs related to TRPV6 Antibody (NBP1-74138).

Blogs on TRPV6.

Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TRPV6 Antibody and receive a gift card or discount.


Gene Symbol TRPV6