TRPM3 Antibody

Images

 
Western Blot: TRPM3 Antibody [NBP2-86876] - WB Suggested Anti-TRPM3 Antibody Titration: 1.25ug/ml. Positive Control: HepG2 cell lysate
Western Blot: TRPM3 Antibody [NBP2-86876] - Host: Rabbit. Target: TRPM3. Positive control (+): Human testis (TE). Negative control (-): Human uterus (UT). Antibody concentration: 0.8ug/m

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRPM3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human TRPM3. Peptide sequence: ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TRPM3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for TRPM3 Antibody

  • EC 2.3.1.31
  • EC 5.99.1.3
  • Long transient receptor potential channel 3
  • LTrpC3
  • LTrpC-3
  • LTRPC3KIAA1616MLSN2GON-2
  • melastatin 2
  • melastatin-2
  • transient receptor potential cation channel subfamily M member 3
  • transient receptor potential cation channel, subfamily M, member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DCLU00
Species: Hu
Applications: ELISA
NB110-81601
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-31133
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-74960
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-12906
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
NBP1-48036
Species: Ca, Hu, Pm, Pm
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-58415
Species: Hu
Applications: IHC, IHC-P
NBP1-97311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-32096
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1617
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-48760
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-12909
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP2-12919
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, MiAr, WB
NBP1-77260
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-70352
Species: Hu, Mu, Rt
Applications: IF, IHC, IHC-P, IP, WB
NBP2-86876
Species: Hu
Applications: WB

Publications for TRPM3 Antibody (NBP2-86876) (0)

There are no publications for TRPM3 Antibody (NBP2-86876).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRPM3 Antibody (NBP2-86876) (0)

There are no reviews for TRPM3 Antibody (NBP2-86876). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRPM3 Antibody (NBP2-86876) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRPM3 Products

Array NBP2-86876

Bioinformatics Tool for TRPM3 Antibody (NBP2-86876)

Discover related pathways, diseases and genes to TRPM3 Antibody (NBP2-86876). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRPM3 Antibody (NBP2-86876)

Discover more about diseases related to TRPM3 Antibody (NBP2-86876).
 

Pathways for TRPM3 Antibody (NBP2-86876)

View related products by pathway.

PTMs for TRPM3 Antibody (NBP2-86876)

Learn more about PTMs related to TRPM3 Antibody (NBP2-86876).

Blogs on TRPM3.

Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRPM3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPM3