TRPC6 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRPC6. Source: E. coli Amino Acid Sequence: WHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
TRPC6 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55831. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
22 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for TRPC6 Recombinant Protein Antigen
Background
The protein encoded by the TRPC6 gene creates receptor-activated cation permeant calcium channels in the cell membrane. Isoform 1 is 931 amino acids in length and is approximately 106 kDa, while isoform 2 is 815 amino acids in lenth at around 93 kDA. Isoform 3 is 876 amino acids long and is just over 100 kDA. Focal segmental glomerulosclerosis 2 (FSGS2) is caused by deficits in the TRPC6 gene. This gene has been linked to diseases such as cystic fibrosis, gigantism, hypertension, kidney disease, glomerulosclerosis, pyloric stenosis, diencephalic neoplasm, premature ovarian failure, and hepatopulmonary syndrome. The TRPC6 gene interacts with MX1, ORAI1, NPHS1, NPHS2, and FYN genes in pathways that monitor sodium as well as calcium channels, EPO signaling pathway, G alpha (q) signaling events, signal transduction, and platelet homeostasis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Mu
Applications: IHC
Species: Hu
Applications: IHC, KO, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), WB
Species: Ca, Hu, Pm, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, PLA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for TRPC6 Recombinant Protein Antigen (NBP2-55831PEP) (0)
There are no publications for TRPC6 Recombinant Protein Antigen (NBP2-55831PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TRPC6 Recombinant Protein Antigen (NBP2-55831PEP) (0)
There are no reviews for TRPC6 Recombinant Protein Antigen (NBP2-55831PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for TRPC6 Recombinant Protein Antigen (NBP2-55831PEP) (0)
Additional TRPC6 Products
Research Areas for TRPC6 Recombinant Protein Antigen (NBP2-55831PEP)
Find related products by research area.
|
Blogs on TRPC6