TRPC3 Antibody - BSA Free

Western Blot: TRPC3 Antibody [NBP2-93499] - Analysis of extracts of various cell lines, using TRPC3 at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRPC3 Antibody - BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human TRPC3 (NP_001124170.1). FRVKTTQFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQLWNVLDFGMLSIFIAAFTARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRPC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TRPC3 Antibody - BSA Free

• hTrp3
• hTrp-3
• short transient receptor potential channel 3
• transient receptor potential cation channel, subfamily C, member 3
• transient receptor potential channel 3
• Transient receptor protein 3
• TRP3
• TRP-3
• TRPC3

Background

The transient receptor potential canonical (TRPC) group of channels, including TPRC3, is a family of receptor-activated non-selective calcium permeant cation channels. In vitro TRPC proteins can form hetero- or homo-oligomeric channels. Endogenous TRPC1, TRPC3 and TRPC7 participate in forming heteromeric store-operated channels, while TRPC3 and TRPC7 can also participate in forming heteromeric receptor-operated channels. TRPC3 plays important roles in neuronal differentiation and immune cell maturation by mediating the cationic current in response to phospholipase C activation, Ca(2+) depletion, and diacylglycerol stimulation. TRPC3 channels are highly expressed in pontine neurons and mediate a nonselective cation current in response to the neurotrophin receptor, TrkB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for TRPC3 Antibody (NBP2-93499). (Showing 1 - 1 of 1 FAQ).

1. I would like to test some of your TRPC3 antibodies in my model system (Xenopus), but they have not been proven to work in this species. Do you offer any guarantee, or beta testing program. We would be happy to send you any images we produce if the antibody works (WB, IHC, ICC). We know that TRPC1-5 are expressed in our system (Xenopus spinal cord).
   • We do offer a testing program, the Innovators Reward Program. Our Innovator’s Reward program is designed to support your innovative research with minimal financial risk to you. Should you decide to use one of our products in an application or species for which it has not been tested all you need to do is submit a full review of the antibody with an image to qualify.

Bioinformatics

• Gene Symbol: TRPC3