TROY/TNFRSF19 Antibody (1R8Y5)

Western Blot: TROY/TNFRSF19 Antibody (1R8Y5) [NBP3-15699] - Western blot analysis of extracts of various cell lines, using TROY/TNFRSF19 antibody (NBP3-15699) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 1R8Y5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

TROY/TNFRSF19 Antibody (1R8Y5) Summary

• Description: Novus Biologicals Rabbit TROY/TNFRSF19 Antibody (1R8Y5) (NBP3-15699) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human TROY/TNFRSF19 (Q9NS68). RFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCASKVNLVKIASTASSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEK
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TNFRSF19
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TROY/TNFRSF19 Antibody (1R8Y5)

• TAJ
• TAJ-alpha
• TAJToxicity and JNK inducer
• TNFRSF19
• TRADE
• TROY
• TROYtumor necrosis factor receptor superfamily member 19
• tumor necrosis factor receptor superfamily, member 19

Background

TROY is a member of the TNF receptor superfamily. This receptor is highly expressed during embryonic development. It has been shown to interact with TRAF family members, and to activate the JNK signaling pathway when overexpressed in cells. This receptor is capable of inducing apoptosis by a caspase-independent mechanism, and it is thought to play an essential role in embryonic development. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TNFRSF19