Recombinant Human TROP-2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TROP-2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 27 - 323 of Human TACSTD2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TACSTD2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TROP-2 Protein

  • Cell surface glycoprotein Trop-2
  • EGP1
  • EGP-1
  • epithelial glycoprotein-1
  • GA733-1
  • GA733-1GP50
  • gastrointestinal tumor-associated antigen GA7331
  • gp50
  • M1S1cell surface glycoprotein TROP2
  • Membrane component chromosome 1 surface marker 1
  • membrane component, chromosome 1, surface marker 1
  • Pancreatic carcinoma marker protein GA733-1
  • pancreatic carcinoma marker protein GA7331,40kD glycoprotein, identified by monoclonal GA733
  • T16
  • TACSTD2
  • TROP2
  • TROP-2
  • TROP2GA7331
  • tumor-associated calcium signal transducer 2

Background

TACSTD2( AAH09409, 27 a.a. - 324 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF650
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-88606
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-85747
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, IP
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
MAB1774
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05027
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-34844
Species: Hu, Mu, Bv, Rb
Applications: WB, IHC-Fr, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
H00004070-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for TROP-2 Recombinant Protein (H00004070-P01) (0)

There are no publications for TROP-2 Recombinant Protein (H00004070-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TROP-2 Recombinant Protein (H00004070-P01) (0)

There are no reviews for TROP-2 Recombinant Protein (H00004070-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TROP-2 Recombinant Protein (H00004070-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TROP-2 Products

Bioinformatics Tool for TROP-2 Recombinant Protein (H00004070-P01)

Discover related pathways, diseases and genes to TROP-2 Recombinant Protein (H00004070-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TROP-2 Recombinant Protein (H00004070-P01)

Discover more about diseases related to TROP-2 Recombinant Protein (H00004070-P01).
 

Pathways for TROP-2 Recombinant Protein (H00004070-P01)

View related products by pathway.

PTMs for TROP-2 Recombinant Protein (H00004070-P01)

Learn more about PTMs related to TROP-2 Recombinant Protein (H00004070-P01).
 

Research Areas for TROP-2 Recombinant Protein (H00004070-P01)

Find related products by research area.

Blogs on TROP-2

There are no specific blogs for TROP-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TROP-2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TACSTD2
Entrez