We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

TROP-2 Recombinant Protein Antigen

Images

 
There are currently no images for TROP-2 Recombinant Protein Antigen (NBP2-49166PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TROP-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TROP-2.

Source: E. coli

Amino Acid Sequence: AFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGEVDIGDAAYYFERDIKGESL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TACSTD2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49166.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TROP-2 Recombinant Protein Antigen

  • Cell surface glycoprotein Trop-2
  • EGP1
  • EGP-1
  • epithelial glycoprotein-1
  • GA733-1
  • GA733-1GP50
  • gastrointestinal tumor-associated antigen GA7331
  • gp50
  • M1S1cell surface glycoprotein TROP2
  • Membrane component chromosome 1 surface marker 1
  • membrane component, chromosome 1, surface marker 1
  • Pancreatic carcinoma marker protein GA733-1
  • pancreatic carcinoma marker protein GA7331,40kD glycoprotein, identified by monoclonal GA733
  • T16
  • TACSTD2
  • TROP2
  • TROP-2
  • TROP2GA7331
  • tumor-associated calcium signal transducer 2

Background

TROP2 encodes a carcinoma-associated antigen defined by the monoclonal antibody GA733. This antigen is a member of a family including at least two type I membrane proteins. It transduces an intracellular calcium signal and acts as a cell surface receptor. Mutations of this gene result in gelatinous drop-like corneal dystrophy, an autosomal recessive disorder characterized by severe corneal amyloidosis leading to blindness. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF960
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF650
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
AF2935
Species: Hu
Applications: WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00009076-M01
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-92405
Species: Hu, Mu, Rt
Applications: WB
NBP1-85047
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1437
Species: Mu
Applications: AdBlk, CyTOF-ready, Flow, ICC, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB120-10109
Species: Hu
Applications: CyTOF-ready, IHC,  IHC-P, S-ELISA, WB
NBP1-87402
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, KD, WB
NBP2-79718
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF2747
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
202-IL
Species: Hu
Applications: BA
7268-CT
Species: Hu
Applications: BA
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
NBP2-49166PEP
Species: Hu
Applications: AC

Publications for TROP-2 Recombinant Protein Antigen (NBP2-49166PEP) (0)

There are no publications for TROP-2 Recombinant Protein Antigen (NBP2-49166PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TROP-2 Recombinant Protein Antigen (NBP2-49166PEP) (0)

There are no reviews for TROP-2 Recombinant Protein Antigen (NBP2-49166PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TROP-2 Recombinant Protein Antigen (NBP2-49166PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TROP-2 Products

Research Areas for TROP-2 Recombinant Protein Antigen (NBP2-49166PEP)

Find related products by research area.

Blogs on TROP-2

There are no specific blogs for TROP-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TROP-2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TACSTD2