TRMT5 Antibody

Images

 
Western Blot: TRMT5 Antibody [NBP1-52876] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRMT5 Antibody Summary

Immunogen
Synthetic peptides corresponding to TRMT5(TRM5 tRNA methyltransferase 5 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of TRMT5. Peptide sequence EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRMT5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TRMT5 and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TRMT5 Antibody

  • KIAA1393EC 2.1.1.31
  • M1G-methyltransferase
  • TRM5 tRNA methyltransferase 5 homolog (S. cerevisiae)
  • TRM5MGC111453
  • tRNA (guanine-N(1)-)-methyltransferase
  • tRNA [GM37] methyltransferase
  • tRNA methyltransferase 5
  • tRNA-N1G37 methyltransferase

Background

tRNAs contain as many as 13 or 14 nucleotides that are modified posttranscriptionally by enzymes that are highly specific for particular nucleotides in the tRNA structure. TRMT5 methylates the N1 position of guanosine-37 (G37) in selected tRNAs using S-adenosyl methionine.tRNAs contain as many as 13 or 14 nucleotides that are modified posttranscriptionally by enzymes that are highly specific for particular nucleotides in the tRNA structure. TRMT5 methylates the N1 position of guanosine-37 (G37) in selected tRNAs using S-adenosyl methionine (Brule et al., 2004 [PubMed 15248782]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20728
Species: Hu
Applications: WB
NBP1-05767
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-76585
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
AF972
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-84891
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83814
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46016
Species: Hu, Mu, Ca, Mk
Applications: WB, IF
NBP2-27464
Species: Hu
Applications: WB, PEP-ELISA
NBP1-83633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20030
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-63270
Species: Hu
Applications: WB, ELISA
H00009097-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-88492
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82652
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TRMT5 Antibody (NBP1-52876) (0)

There are no publications for TRMT5 Antibody (NBP1-52876).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRMT5 Antibody (NBP1-52876) (0)

There are no reviews for TRMT5 Antibody (NBP1-52876). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRMT5 Antibody (NBP1-52876) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRMT5 Products

Bioinformatics Tool for TRMT5 Antibody (NBP1-52876)

Discover related pathways, diseases and genes to TRMT5 Antibody (NBP1-52876). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TRMT5 Antibody (NBP1-52876)

View related products by pathway.

PTMs for TRMT5 Antibody (NBP1-52876)

Learn more about PTMs related to TRMT5 Antibody (NBP1-52876).

Blogs on TRMT5

There are no specific blogs for TRMT5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRMT5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRMT5
Uniprot