TRMT12 Antibody

Images

 
Western Blot: TRMT12 Antibody [NBP1-83633] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: TRMT12 Antibody [NBP1-83633] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: TRMT12 Antibody [NBP1-83633] - Staining of human colon shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRMT12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:WFTQRYREYLQRQKLFDTQHRVEKMPDGSVALPVLGETLPEQHLQELRNRVAPGSPCMLTQLPDPVPSKRAQGCSPAQKLCLEVSRWVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRMT12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRMT12 Protein (NBP1-83633PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRMT12 Antibody

  • Alpha-amino-alpha-carboxypropyl transferase TYW2
  • EC 2.1.1
  • EC 2.1.1.32
  • EC 2.5.1.-
  • FLJ20772
  • homolog of yeast tRNA methyltransferase
  • TRM12
  • tRNA methyltranferase 12 homolog (S. cerevisiae)
  • tRNA methyltranferase 12 homolog
  • tRNA methyltransferase 12 homolog (S. cerevisiae)
  • tRNA-yW synthesizing protein 2
  • tRNA-yW-synthesizing protein 2
  • TYW2tRNA wybutosine-synthesizing protein 2 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83814
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76585
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-88492
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-63270
Species: Hu
Applications: WB, ELISA
NBP1-82909
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TRMT12 Antibody (NBP1-83633) (0)

There are no publications for TRMT12 Antibody (NBP1-83633).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRMT12 Antibody (NBP1-83633) (0)

There are no reviews for TRMT12 Antibody (NBP1-83633). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRMT12 Antibody (NBP1-83633) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRMT12 Products

Bioinformatics Tool for TRMT12 Antibody (NBP1-83633)

Discover related pathways, diseases and genes to TRMT12 Antibody (NBP1-83633). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRMT12 Antibody (NBP1-83633)

Discover more about diseases related to TRMT12 Antibody (NBP1-83633).
 

Pathways for TRMT12 Antibody (NBP1-83633)

View related products by pathway.

Blogs on TRMT12

There are no specific blogs for TRMT12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRMT12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRMT12