TRMT12 Antibody - BSA Free

Western Blot: TRMT12 Antibody [NBP1-83633] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: TRMT12 Antibody [NBP1-83633] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.

Staining of human colon shows moderate nuclear positivity in glandular cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRMT12 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRMT12 Antibody - BSA Free (NBP1-83633) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: WFTQRYREYLQRQKLFDTQHRVEKMPDGSVALPVLGETLPEQHLQELRNRVAPGSPCMLTQLPDPVPSKRAQGCSPAQKLCLEVSRWVE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRMT12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TRMT12 Protein (NBP1-83633PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TRMT12 Antibody - BSA Free

• Alpha-amino-alpha-carboxypropyl transferase TYW2
• EC 2.1.1
• EC 2.1.1.32
• EC 2.5.1.-
• FLJ20772
• homolog of yeast tRNA methyltransferase
• TRM12
• tRNA methyltranferase 12 homolog (S. cerevisiae)
• tRNA methyltranferase 12 homolog
• tRNA methyltransferase 12 homolog (S. cerevisiae)
• tRNA-yW synthesizing protein 2
• tRNA-yW-synthesizing protein 2
• TYW2tRNA wybutosine-synthesizing protein 2 homolog

Background

Wybutosine (yW) is a hypermodified guanosine at the 3-prime position adjacent to the anticodon of phenylalanine tRNA that stabilizes codon-anticodon interactions during decoding on the ribosome. TRMT12 is the human homolog of a yeast gene essential for yW synthesis (Noma and Suzuki, 2006).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRMT12