TYW3 Antibody

Images

 
Western Blot: TYW3 Antibody [NBP1-88492] - Analysis in control (vector only transfected HEK293T lysate) and TYW3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: TYW3 Antibody [NBP1-88492] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: TYW3 Antibody [NBP1-88492] - Staining of human testis shows moderate cytoplasmic positivity in seminiferus duct cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TYW3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EFRKWKAQCLSKADLSRKGSVDEDVVELVQFLNMRDQFFTTSSCAGRILLLDRGINGFEVQKQNCCWLLVTHKLCVKDDVIV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TYW3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TYW3 Protein (NBP1-88492PEP)
Publications
Read Publication using
NBP1-88492 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TYW3 Antibody

  • C1orf171
  • chromosome 1 open reading frame 171
  • EC 2.1.1
  • EC 2.1.1.-
  • FLJ40918
  • tRNA wybutosine-synthesizing protein 3 homolog
  • tRNA-yW synthesizing protein 3 homolog (S. cerevisiae)
  • tRNA-yW-synthesizing protein 3

Background

Wybutosine (yW) is a hypermodified guanosine at the 3-prime position adjacent to the anticodon of phenylalanine tRNA that stabilizes codon-anticodon interactions during decoding on the ribosome. TYW3 is the human homolog of a yeast gene essential for yW synthesis (Noma and Suzuki, 2006).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TYW3 Antibody (NBP1-88492)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-88492 Applications Species
Zhang X, Liu K, Zhou H et al. Activation of hepatic embryonic stem cell factors are essential biopredictive markers for hepatocellular carcinoma Research Square 2023-07-13 (IHC, Human) IHC Human

Reviews for TYW3 Antibody (NBP1-88492) (0)

There are no reviews for TYW3 Antibody (NBP1-88492). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TYW3 Antibody (NBP1-88492) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TYW3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TYW3