TYW3 Antibody

Images

 
Western Blot: TYW3 Antibody [NBP1-88492] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: TYW3 Antibody [NBP1-88492] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: TYW3 Antibody [NBP1-88492] - Staining of human testis shows moderate cytoplasmic positivity in seminiferus duct cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TYW3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EFRKWKAQCLSKADLSRKGSVDEDVVELVQFLNMRDQFFTTSSCAGRILLLDRGINGFEVQKQNCCWLLVTHKLCVKDDVIV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TYW3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TYW3 Protein (NBP1-88492PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TYW3 Antibody

  • C1orf171
  • chromosome 1 open reading frame 171
  • EC 2.1.1
  • EC 2.1.1.-
  • FLJ40918
  • tRNA wybutosine-synthesizing protein 3 homolog
  • tRNA-yW synthesizing protein 3 homolog (S. cerevisiae)
  • tRNA-yW-synthesizing protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83814
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76585
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-83633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82909
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89533
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-86481
Species: Hu
Applications: IHC, IHC-P
NB100-63270
Species: Hu
Applications: WB, ELISA

Publications for TYW3 Antibody (NBP1-88492) (0)

There are no publications for TYW3 Antibody (NBP1-88492).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TYW3 Antibody (NBP1-88492) (0)

There are no reviews for TYW3 Antibody (NBP1-88492). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TYW3 Antibody (NBP1-88492) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TYW3 Products

Bioinformatics Tool for TYW3 Antibody (NBP1-88492)

Discover related pathways, diseases and genes to TYW3 Antibody (NBP1-88492). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TYW3 Antibody (NBP1-88492)

Discover more about diseases related to TYW3 Antibody (NBP1-88492).
 

Pathways for TYW3 Antibody (NBP1-88492)

View related products by pathway.

PTMs for TYW3 Antibody (NBP1-88492)

Learn more about PTMs related to TYW3 Antibody (NBP1-88492).

Blogs on TYW3

There are no specific blogs for TYW3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TYW3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TYW3