CGI-09 Antibody

Images

 
Western Blot: CGI-09 Antibody [NBP2-13486] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: CGI-09 Antibody [NBP2-13486] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemistry-Paraffin: CGI-09 Antibody [NBP2-13486] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CGI-09 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KMIVMETCAGLVLGAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFL SGLYEFPLNKVDSLLHGTFSAKMLSSEPKDSALVEESNGTLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRMT6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CGI-09 Protein (NBP2-13486PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CGI-09 Antibody

  • CGI-09
  • GCD10
  • Gcd10p
  • KIAA1153
  • MGC5029
  • TRM6
  • tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit TRM6
  • tRNA methyltransferase 6 homolog (S. cerevisiae)
  • tRNA(m1A58)-methyltransferase subunit TRM6
  • tRNA(m1A58)MTase subunit TRM6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20728
Species: Hu
Applications: WB
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00022894-B01P
Species: Hu, Ch
Applications: WB, ELISA, ICC/IF
AF972
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-85092
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-60949
Species: AB, Bv, Gt, Sh, WB
Applications: Flow, Func, IHC
H00000518-R01
Species: Hu
NBP1-82909
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-84863
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-13729
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CGI-09 Antibody (NBP2-13486) (0)

There are no publications for CGI-09 Antibody (NBP2-13486).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CGI-09 Antibody (NBP2-13486) (0)

There are no reviews for CGI-09 Antibody (NBP2-13486). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CGI-09 Antibody (NBP2-13486) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CGI-09 Products

Bioinformatics Tool for CGI-09 Antibody (NBP2-13486)

Discover related pathways, diseases and genes to CGI-09 Antibody (NBP2-13486). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CGI-09

There are no specific blogs for CGI-09, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CGI-09 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRMT6