TrkA Recombinant Protein Antigen

Images

 
There are currently no images for TrkA Protein (NBP2-38265PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TrkA Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NTRK1.

Source: E. coli

Amino Acid Sequence: KSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NTRK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38265.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TrkA Recombinant Protein Antigen

  • DKFZp781I14186
  • EC 2.7.10
  • EC 2.7.10.1
  • MTChigh affinity nerve growth factor receptor
  • Neurotrophic tyrosine kinase receptor type 1
  • neurotrophic tyrosine kinase, receptor, type 1
  • NTRK1
  • NTRK-1
  • p140-TrkA
  • TRK1-transforming tyrosine kinase protein
  • TrkA
  • Trk-A
  • TRKAOncogene TRK
  • TRKTRK1
  • tyrosine kinase receptor A

Background

The Trk proto-oncogene encodes a 140 kDa, membrane-spanning protein tyrosine kinase that is expressed only in neural tissues. Nerve growth factor (NGF) stimulates phosphorylation of Trk A in neural cell lines and in embryonic dorsal root ganglia. Affinity cross-linking and equilibrium binding experiments with 125I-labeled NGF indicate that Trk A binds NGF specifically in cultured cells with a dissociation constant of 10(-9) molar. The identification of Trk A as an NGF receptor indicates that this protein participates in the primary signal transduction mechanism of NGF (1). Trk A was found to be expressed in the nervous system and phosphorylated in response to NGF (Nerve Growth Factor). Somatic rearrangement(s) of the TRKA gene (also designated NTRK1) are responsible for formation of some oncogenes (2). Trk A is expressed in neural and nonneuronal tissues. Like RET, Trk A is often activated by rearrangements that involve one of at least five other genes in papillary thyroid carcinoma (PTC) (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DBD00
Species: Hu
Applications: ELISA
AF1157
Species: Mu
Applications: IHC, WB
256-GF
Species: Hu
Applications: BA
267-N3
Species: Hu
Applications: BA
AF1494
Species: Hu, Mu, Rt
Applications: Block, IHC, Simple Western, WB
AF1404
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
AF3468
Species: Hu
Applications: ICC, KO, Simple Western, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
DRT200
Species: Hu
Applications: ELISA
NBP1-18910
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
H00003059-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, KD, PLA, S-ELISA, WB
MAB224
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
AF1138
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
AF482
Species: Mu
Applications: IHC, WB
268-N4
Species: Hu
Applications: BA
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-38265PEP
Species: Hu
Applications: AC

Publications for TrkA Protein (NBP2-38265PEP) (0)

There are no publications for TrkA Protein (NBP2-38265PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TrkA Protein (NBP2-38265PEP) (0)

There are no reviews for TrkA Protein (NBP2-38265PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TrkA Protein (NBP2-38265PEP). (Showing 1 - 1 of 1 FAQ).

  1. I am searching (with difficulty) for an antibody against Trka which can be used in flow cytometry. Since I am planning to use it for bead sorting of live cells it needs to be for a part of the receptor which is on the outside of the cell. Please can you let me know if you can help me with this.
    • NBP1-47436, NB100-98815 and NB100-65266 all bind to the extracellular domain of Trka, however, none of them are guaranteed for use in flow cytometry. Our only flow cytometry guaranteed antibodies bind to the intracellular domain. This does not mean one of these antibodies won't work for flow, we just can not guarantee it. If you would be interested in testing this novel application on one of our Trka antibodies, please take a look at our Innovators Reward Program.

Additional TrkA Products

Research Areas for TrkA Protein (NBP2-38265PEP)

Find related products by research area.

Blogs on TrkA.

Successful Transplantation of Friedreich Ataxia Induced Pluripotent Stem Cell (iPSC)-Derived Sensory Neurons in Dorsal Root Ganglia of Adult Rodents
Jamshed Arslan, Pharm D, PhD The dorsal root ganglia (DRG) are a collection of cell bodies of sensory nerves carrying sensory information – including nociception, mechanoreception and proprioception – from periphera...  Read full blog post.

TrkB: Bridging Ontogenesis and Oncogenesis
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. Interaction of brain-derived neurotrophic factor (BDNF) with its ...  Read full blog post.

TrkB: Docking for Neurotrophins and Beyond.
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. TrK's are activated by several neurotrophins, which are small pro...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TrkA Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NTRK1