TRIM72 Antibody (2B8) - Azide and BSA Free

Western Blot: TRIM72 Antibody (2B8) [H00493829-M04] - Analysis of TRIM72 expression in HepG2.

Immunoprecipitation: TRIM72 Antibody (2B8) [H00493829-M04] - Analysis of TRIM72 transfected lysate using anti-TRIM72 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TRIM72 rabbit polyclonal antibody.

Sandwich ELISA: TRIM72 Antibody (2B8) [H00493829-M04] - Detection limit for recombinant GST tagged TRIM72 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IP
• Clone: 2B8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TRIM72 Antibody (2B8) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse TRIM72 Antibody (2B8) - Azide and BSA Free (H00493829-M04) is a monoclonal antibody validated for use in WB, ELISA and IP. Anti-TRIM72 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: TRIM72 (NP_001008275.1, 378 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPEGAEA
• Specificity: LOC493829 - similar to tripartite motif-containing 4 (2B8)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TRIM72
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot
• Application Notes: This product is useful for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRIM72 Antibody (2B8) - Azide and BSA Free

• MG53Mg53
• Mitsugumin-53
• tripartite motif containing 72
• tripartite motif-containing 72
• tripartite motif-containing protein 72

Background

Muscle-specific protein that plays a central role in cell membrane repair by nucleating the assembly of therepair machinery at injury sites. Specifically binds phosphatidylserine. Acts as a sensor of oxidation: upon membranedamage, entry of extracellular oxidative environment results in disulfide bond formation and homooligomerization atthe injury site. This oligomerization acts as a nucleation site for recruitment of TRIM72-containing vesicles to theinjury site, leading to membrane patch formation. Probably acts upstream of the Ca(2+)-dependent membrane resealingprocess. Required for transport of DYSF to sites of cell injury during repair patch formation. Regulates membranebudding and exocytosis. May be involved in the regulation of the mobility of KCNB1-containing endocytic vesicles (Bysimilarity)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRIM72 Antibody (H00493829-M04)(1)

Publication using H00493829-M04

• Lemckert FA, Bournazos A, Eckert DM et al. Lack of MG53 in human heart precludes utility as a biomarker of myocardial injury or endogenous cardioprotective factor. Cardiovasc Res 2016-05-15 [PMID: 26790476]

Bioinformatics

• Gene Symbol: TRIM72
• Entrez:
  • 493829(Human)
• Uniprot:
  • NP_001008275(Human)