TRIM68 Antibody


Immunocytochemistry/ Immunofluorescence: TRIM68 Antibody [NBP1-83863] - Staining of human cell line U-2 OS shows positivity in nucleus, nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: TRIM68 Antibody [NBP1-83863] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

TRIM68 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KLELNHSELIQQSQVLWRMIAELKERSQRPVRWMLQDIQEVLNRSKSWSLQQPEPISLELKTDCRVLG
Specificity of human TRIM68 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRIM68 Protein (NBP1-83863PEP)

Reactivity Notes

Rat (82%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TRIM68 Antibody

  • EC 6.3.2.-
  • FLJ10369
  • GC109MGC126176
  • RING finger protein 137RNF137
  • Ro/SSA1 related protein
  • SS56E3 ubiquitin-protein ligase TRIM68
  • SS-56SSA protein SS-56
  • tripartite motif containing 68
  • tripartite motif-containing 68
  • Tripartite motif-containing protein 68


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P, IP
Species: Hu
Applications: WB, Simple Western, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA, CHIP-SEQ
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TRIM68 Antibody (NBP1-83863) (0)

There are no publications for TRIM68 Antibody (NBP1-83863).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM68 Antibody (NBP1-83863) (0)

There are no reviews for TRIM68 Antibody (NBP1-83863). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TRIM68 Antibody (NBP1-83863) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TRIM68 Products

Bioinformatics Tool for TRIM68 Antibody (NBP1-83863)

Discover related pathways, diseases and genes to TRIM68 Antibody (NBP1-83863). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM68 Antibody (NBP1-83863)

Discover more about diseases related to TRIM68 Antibody (NBP1-83863).

Pathways for TRIM68 Antibody (NBP1-83863)

View related products by pathway.

PTMs for TRIM68 Antibody (NBP1-83863)

Learn more about PTMs related to TRIM68 Antibody (NBP1-83863).

Research Areas for TRIM68 Antibody (NBP1-83863)

Find related products by research area.

Blogs on TRIM68

There are no specific blogs for TRIM68, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TRIM68 Antibody and receive a gift card or discount.


Gene Symbol TRIM68