TRIM14 Antibody

Images

 
Western Blot: TRIM14 Antibody [NBP3-10346] - Western blot analysis using NBP3-10346 on Human Liver as a positive control. Antibody Titration: 0.2-1 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

TRIM14 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRIM14 (NP_150090). Peptide sequence SFEPVKSFFKGLVEAVESTLQTPLDIRLSPTNHAYSALKVSSPRLVSNRP
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM14
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for TRIM14 Antibody

  • KIAA0129tripartite motif-containing 14
  • tripartite motif containing 14
  • tripartite motif protein TRIM14
  • tripartite motif-containing protein 14

Background

TRIM14 is encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been determined. Four alternatively spliced transcript variants for this gene have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRIM14 Antibody (NBP3-10346) (0)

There are no publications for TRIM14 Antibody (NBP3-10346).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM14 Antibody (NBP3-10346) (0)

There are no reviews for TRIM14 Antibody (NBP3-10346). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM14 Antibody (NBP3-10346) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM14 Products

Research Areas for TRIM14 Antibody (NBP3-10346)

Find related products by research area.

Blogs on TRIM14

There are no specific blogs for TRIM14, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM14