TRIM Antibody

Images

 
Immunohistochemistry: TRIM Antibody [NBP1-89660] - Staining of human tonsil shows cytoplasmic positivity in lymphoid cells outside the reaction centra.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIM Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRIM Protein (NBP1-89660PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIM Antibody

  • pp29/30
  • T cell receptor associated transmembrane adaptor 1
  • T cell receptor interacting molecule
  • T-cell receptor interacting molecule
  • T-cell receptor-associated transmembrane adapter 1
  • T-cell receptor-interacting molecule
  • TCRIM
  • TRAT1
  • TRIM
  • TRIMHSPC062

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-76601
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-49156
Species: Hu
Applications: ICC/IF, IHC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-27084
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NB600-1397
Species: Hu, Bv, Ca, Mk, Rb
Applications: WB, Flow, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-58661
Species: Hu
Applications: IHC-P
NBP1-89660
Species: Hu
Applications: IHC, IHC-P

Publications for TRIM Antibody (NBP1-89660) (0)

There are no publications for TRIM Antibody (NBP1-89660).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM Antibody (NBP1-89660) (0)

There are no reviews for TRIM Antibody (NBP1-89660). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRIM Antibody (NBP1-89660) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM Products

Bioinformatics Tool for TRIM Antibody (NBP1-89660)

Discover related pathways, diseases and genes to TRIM Antibody (NBP1-89660). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM Antibody (NBP1-89660)

Discover more about diseases related to TRIM Antibody (NBP1-89660).
 

Pathways for TRIM Antibody (NBP1-89660)

View related products by pathway.

Blogs on TRIM

There are no specific blogs for TRIM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAT1
Entrez