TRIB3 Antibody (3P4O1)

Western Blot: TRIB3 Antibody (3P4O1) [NBP3-33528] - Western blot analysis of lysates from K-562 cells, using TRIB3 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3P4O1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

TRIB3 Antibody (3P4O1) Summary

• Description: Novus Biologicals Rabbit TRIB3 Antibody (3P4O1) (NBP3-33528) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TRIB3(Q96RU7)
  
  Sequence:
  MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAVATASRLGPYVLLEPEEGG
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TRIB3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TRIB3 Antibody (3P4O1)

• C20orf97
• dJ1103G7.3
• neuronal cell death inducible putative kinase
• Neuronal cell death-inducible putative kinase
• NIPK
• p65-interacting inhibitor of NF-kappaB
• p65-interacting inhibitor of NF-kappa-B
• SINK
• SKIP3
• TRB-3
• TRB3chromosome 20 open reading frame 97
• tribbles homolog 3 (Drosophila)
• tribbles homolog 3

Background

TRIB3 is encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRIB3