![Western Blot: TRIB1 Antibody (4A10) [H00010221-M01] - TRIB1 monoclonal antibody (M01), clone 4A10. Analysis of TRIB1 expression in human colon.](http://images.novusbio.com/fullsize/TRIB1-Antibody-4A10-Western-Blot-H00010221-M01-img0006.jpg "Western Blot: TRIB1 Antibody (4A10) [H00010221-M01] - TRIB1 monoclonal antibody (M01), clone 4A10. Analysis of TRIB1 expression in human colon.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 4A10 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse TRIB1 Antibody (4A10) - Azide and BSA Free (H00010221-M01) is a monoclonal antibody validated for use in WB and ELISA. Anti-TRIB1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | TRIB1 (NP_079471, 91 a.a. ~ 191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSHSNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVS |
| Specificity | TRIB1 - tribbles homolog 1 (Drosophila) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TRIB1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against tissue lysate and recombinant protein for western blot. It has also been used for ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Publication using H00010221-M01 | Applications | Species |
|---|---|---|
| Ji W, Bian Z, Yu Y et al. Expulsion of micronuclei containing amplified genes contributes to a decrease in double minute chromosomes from malignant tumor cells. Int J Cancer 2013-09-13 [PMID: 24027017] |
Secondary Antibodies |
Isotype Controls |
Research Areas for TRIB1 Antibody (H00010221-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: TRIB1 Antibody (4A10) [H00010221-M01] - TRIB1 monoclonal antibody (M01), clone 4A10. Western Blot analysis of TRIB1 expression in human spleen.](http://images.novusbio.com/fullsize/TRIB1-Antibody-4A10-Western-Blot-H00010221-M01-img0001.jpg "Western Blot: TRIB1 Antibody (4A10) [H00010221-M01] - TRIB1 monoclonal antibody (M01), clone 4A10. Western Blot analysis of TRIB1 expression in human spleen.")
![Western Blot: TRIB1 Antibody (4A10) [H00010221-M01] - TRIB1 monoclonal antibody (M01), clone 4A10. Analysis of TRIB1 expression in human stomach.](http://images.novusbio.com/fullsize/TRIB1-Antibody-4A10-Western-Blot-H00010221-M01-img0007.jpg "Western Blot: TRIB1 Antibody (4A10) [H00010221-M01] - TRIB1 monoclonal antibody (M01), clone 4A10. Analysis of TRIB1 expression in human stomach.")
![Sandwich ELISA: TRIB1 Antibody (4A10) [H00010221-M01] - Detection limit for recombinant GST tagged TRIB1 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/TRIB1-Antibody-4A10-Sandwich-ELISA-H00010221-M01-img0005.jpg "Sandwich ELISA: TRIB1 Antibody (4A10) [H00010221-M01] - Detection limit for recombinant GST tagged TRIB1 is approximately 0.1ng/ml as a capture antibody.")
![N/A Angiopoietin-like Protein 3/ANGPTL3 [HRP]](https://images.novusbio.com/images2/Angiopoietin-like_Protein_3_DANL30_ELISA_31.jpg)
![N/A Angiopoietin-like Protein 3/ANGPTL3 [HRP]](https://images.novusbio.com/images2/DATA_Angiopoietinlike_Protein_3_DANL30_ELISA_575.jpg)
![Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunohistochemistry_21186.jpg)
![Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Western_Blot_11656.jpg)
![Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunocytochemistry_11911.jpg)
![Immunohistochemistry Sortilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Sortilin_AF2934_Immunohistochemistry_7161.jpg)
![Western Blot Sortilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Sortilin_AF2934_Western_Blot_19100.jpg)
![Simple Western Sortilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Sortilin_AF2934_Simple_Western_20098.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")