TREML1/TLT-1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: APVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQD |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TREML1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TREML1/TLT-1 Antibody - BSA Free
Background
TREML1 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1(MIM 605085) and TREM2 (MIM 605086), but it has distinct structural and functional properties. TREML1 enhances calciumsignaling in an SHP2 (PTPN11; MIM 176876)-dependent manner (Allcock et al., 2003 (PubMed 12645956); Barrow et al.,2004 (PubMed 15128762)).(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: AgAct, CyTOF-ready, Flow
Species: Mu
Applications: ELISA, ICC, KO, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: Block, ICC, IHC, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Mu
Applications: Block, IHC, WB
Species: Hu
Applications: WB, IHC
Publications for TREML1/TLT-1 Antibody (NBP1-84234) (0)
There are no publications for TREML1/TLT-1 Antibody (NBP1-84234).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TREML1/TLT-1 Antibody (NBP1-84234) (0)
There are no reviews for TREML1/TLT-1 Antibody (NBP1-84234).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TREML1/TLT-1 Antibody (NBP1-84234) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TREML1/TLT-1 Products
Blogs on TREML1/TLT-1