TREM1 Recombinant Protein Antigen

Images

 
There are currently no images for TREM1 Recombinant Protein Antigen (NBP3-21284PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TREM1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TREM1

Source: E.coli

Amino Acid Sequence: LTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TREM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21284. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TREM1 Recombinant Protein Antigen

  • CD354 antigen
  • CD354
  • TREM1
  • TREM-1
  • TREM-1Triggering receptor expressed on monocytes 1
  • triggering receptor expressed on myeloid cells 1
  • triggering-receptor TREM1

Background

Monocyte/macrophage- and neutrophil-mediated inflammatory responses can be stimulated through a variety of receptors, including G protein-linked 7-transmembrane receptors (e.g., FPR1; MIM 136537), Fc receptors (see MIM 146790), CD14 (MIM 158120) and Toll-like receptors (e.g., TLR4; MIM 603030), and cytokine receptors (e.g., IFNGR1; MIM 107470). Engagement of these receptors can also prime myeloid cells to respond to other stimuli. Myeloid cells express receptors belonging to the Ig superfamily, such as TREM1, or to the C-type lectin superfamily. Depending on their transmembrane and cytoplasmic sequence structure, these receptors have either activating (e.g., KIR2DS1; MIM 604952) or inhibitory functions (e.g., KIR2DL1; MIM 604936).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

M6000B
Species: Mu
Applications: ELISA
NBP1-85313
Species: Hu
Applications: IHC,  IHC-P, WB
DY1707
Species: Hu
Applications: ELISA
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
DY417
Species: Mu
Applications: ELISA
AF1729
Species: Mu
Applications: ELISA, ICC, KO, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
AF5739
Species: Hu, Mu, Rt
Applications: WB
DCP00
Species: Hu
Applications: ELISA
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
DC140
Species: Hu
Applications: ELISA
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-84234
Species: Hu
Applications: IHC,  IHC-P, WB
201-LB
Species: Hu
Applications: BA
AF3667
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
NBP3-21284PEP
Species: Hu
Applications: AC

Publications for TREM1 Recombinant Protein Antigen (NBP3-21284PEP) (0)

There are no publications for TREM1 Recombinant Protein Antigen (NBP3-21284PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TREM1 Recombinant Protein Antigen (NBP3-21284PEP) (0)

There are no reviews for TREM1 Recombinant Protein Antigen (NBP3-21284PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TREM1 Recombinant Protein Antigen (NBP3-21284PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TREM1 Products

Research Areas for TREM1 Recombinant Protein Antigen (NBP3-21284PEP)

Find related products by research area.

Blogs on TREM1.

TREM1: An inflammatory signal protein with a potential role in cancer
TREM1 is pro-inflammatory gene that stimulates neutrophil and monocyte-mediated inflammatory responses. This protein is highly expressed in adult liver, lung and spleen. It is also present in the lymph node, spinal cord and heart tissues. TREM-1 plays...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TREM1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TREM1